CAZyme Information: YALI0_A07142g-t26_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI0_A07142g-t26_1-p1
• CAZy Family: AA2
• CAZyme Description: YALI0A07142p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751	CR382127|CGC3	83626.45	9.2837

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB122	7223	284591	775	6448

• Gene Location: location=CR382127:698050-700305(-)

Full Sequence      

MRFSQGLSFLGLVSALAHGQSGTHELEKRQAFGARFNGNPFVPISTADPLGMFPRREHPV
KLPPFVTGSSHTPLGAVPTNNFYTNMLLGTRTLPAYVYPYSVWWSKEDGFSGLAVSHTRR
SQLVYGPDPNRTPTQFYFNPSGIMSIVFSAREFSSTISMRMDSLDHMSVNANTLDESGSL
KMWTPLVRGMGMVTAKYYGVTPVIASQVGFARVQQETSLRLDLLKYRLILNNGITWLMYV
TVPPGESIHFTLSSGNRLVSTNRGNFVVQVAALPDSSSEYALDSAAGSYAVGASVSGNID
QDGLRGSYSINFKHAGSSRWGKPLMFALEHQVQSMTDSMLSTWTMATLDSPAKGQMRGFI
TDKFTMVEPLLPRDVGYLPKAILPNYKSRLDDANVRGIIANAANQEMLQDINSQTNLDSM
YFSGKGLDKFAQLLVVLNDVVGDKARARDLLGRLKNAFSVFANNRQQNPLAYDTVWKGIV
STAGLGTDSTADFGNSYYNDHHFHYGYFVHAAAIIAKIDKELGDGKWLSQNRQWVDNLVR
DYANPSSQDKSFPIHRSFDWWSGHSWAKGLYLSADGKDEESSSEDYHSVYAIKLWGNSSG
NQAMEARANLQLAIMKRAMNTYWYMKDNNRNQPMKFIKNKVPGISFENKADHATYFGMNP
EYIIGIHALPTTPISAYIRDPAFVRETWDQRVAGFINWVDSGWKGTLQLDRSIFDPNAAY
QFFTRGFQSRWLDPGTSLAWSLTMVAGLGGQ

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	69	743	2.1e-222	0.9790996784565916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	40	750	55	757	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	393	742	4	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	5.71e-127	58	379	1	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG83762.2|GH81	0.0	1	751	1	751
AOW00352.1|GH81	0.0	1	751	10	760
QNP95577.1|GH81	0.0	1	751	1	732
CAG82056.2|GH81	0.0	34	751	55	763
AOW02730.1|GH81	0.0	34	751	275	983

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	6.46e-101	41	746	9	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.13e-100	41	746	34	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	5.30e-97	41	746	9	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.25e-26	75	719	33	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	5.33e-25	421	735	361	671	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AIR7|ENG1_CANAL	8.70e-175	34	747	422	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q12168|ENG2_YEAST	4.64e-170	49	742	87	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.23e-166	41	747	194	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	9.55e-161	39	748	401	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.68e-159	42	751	5	705	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001487	0.998481	CS pos: 19-20. Pr: 0.9591

TMHMM  Annotations     

There is no transmembrane helices in YALI0_A07142g-t26_1-p1.