CAZyme Information: XP_003437540.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_003437540.1
• CAZy Family: GT59
• CAZyme Description: Cutinase [Source:UniProtKB/TrEMBL;Acc:B2ANK5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236		25141.58	8.1001

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633872:919428-920248(-)

Full Sequence      

MRFLTTIVAFTGLVTALPSRIEEIRSLDLLEDLSKKQTLVTRQSSQTRNELQTGGTCPPI
IFIYARGSTEGGNLGSLGPLIADVLEANYGANNVWIQGVGGNYKANLLDNLLPDGTTAAA
ITEMKNLFTLASTRCPSAKIVSGGYSQGAALTAAAIRDSTAAIREKIKGVVLFGYTKNRQ
NNGGIPNYPSNRLTVFCESGDLVCSGTLIVTPAHGEYQDEARDQAPKFLIARINAS

Enzyme Prediction     

EC	3.1.1.74:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	57	232	1e-40	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	4.67e-62	57	233	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP65625.1|CE5	2.14e-166	1	236	1	236
CDP31619.1|CE5	2.14e-166	1	236	1	236
VBB84870.1|CE5	5.89e-164	1	236	1	236
VBB71393.1|CE5	9.91e-102	1	236	1	242
CAP59755.1|CE5	3.64e-100	1	236	1	245

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CY3_A	3.86e-77	47	233	5	193	Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY3_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY9_A Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9],7CY9_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9]
5AJH_A	1.07e-76	45	236	19	212	Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005],5AJH_B Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005],5AJH_C Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005]
1CUW_A	1.18e-75	37	235	8	209	Chain A, CUTINASE [Fusarium vanettenii],1CUW_B Chain B, CUTINASE [Fusarium vanettenii]
1XZG_A	1.67e-75	37	235	8	209	Chain A, CUTINASE [Fusarium vanettenii]
1CUG_A	1.67e-75	37	235	8	209	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P41744|CUTI_ALTBR	5.84e-79	43	236	13	209	Cutinase OS=Alternaria brassicicola OX=29001 GN=CUTAB1 PE=2 SV=1
sp|P11373|CUTI1_COLGL	2.08e-75	1	233	1	223	Cutinase 1 OS=Colletotrichum gloeosporioides OX=474922 GN=CUTA PE=1 SV=1
sp|P00590|CUTI1_FUSVN	4.12e-74	37	235	24	225	Cutinase 1 OS=Fusarium vanettenii OX=2747968 GN=CUT1 PE=1 SV=1
sp|Q96UT0|CUTI2_FUSVN	4.25e-74	37	235	24	226	Cutinase 2 OS=Fusarium vanettenii OX=2747968 GN=CUT2 PE=3 SV=1
sp|Q99174|CUTI_FUSSC	5.84e-74	37	235	24	225	Cutinase OS=Fusarium solani subsp. cucurbitae OX=2747967 GN=CUTA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000285	0.999689	CS pos: 16-17. Pr: 0.9817

TMHMM  Annotations     

There is no transmembrane helices in XP_003437540.1.