CAZyme Information: XP_001912538.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001912538.1
• CAZy Family: GT22
• CAZyme Description: Mannosyl-oligosaccharide 1,2-alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:B2AAA8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1122	CU633438|CGC10	124008.30	5.2893

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633438:1233831-1237338(-)

Full Sequence      

MDHDHRDLLSDGGSRSDATRIPIDASARAQMPPESTMIFTRPILRPISWIGWNMLLWCLV
AVMLAPGHVGVAAMSTDRIKELRQETVDMFYHGFDNYMDIAFPEDEVCMHICATIDYFLR
PVSCVPLTRDAKNPRNVELNDVLGNYSLTLIDSLSTLAILASAPPDERGTGPKALADFQH
GVAALVEQYGDGSPGPSGVGQRGRGFDVDSKVQVFETVIRGLGGLLSAHLFAVGALPITG
YKPRHIETDDPLYSQPIVWPNGFKYDGQILRLALDLGQRLLPAFYTKTGMPYPRVNLRHG
IPFYTNSPMHENAPMNPPEGPLEITETCSAGAGSLVLEFTVLSRLTGDPRFEQLAKRAFW
AVWYRKSQIGLIGAGVDAEQGHWIGAYAVIGAGADSFFEYALKSHILLSGHEPPNRTAPA
RKHRGGIDSDNWLDPNALFPPLNDAENSADSFLEAWHLAHAAIKRHLYNEKDHPHYDNVN
LWTGSLVSNWVDSLGAYYSGLLVLAGEVEEAIETNLLYTAIWTRYAALPERYSLRDKTVE
GGLGWWPLRPEFIESTYHIYRATKDPWYLYVGEMVLRDITRRCWTPCGWAGLQNVLDGEK
SDRMESFFLGETAKYMYLLFDDEHPLNSLDAPYVFTTEGHPLIIPKAPPKDGPRRRRSPR
KYLTVYPNEEYTNTCPPRPQTTPLSGSVVAARDDIYHAARLLDLHQLSPTSAYAIDAGQM
SGQHMARSNYTLYPWTLPAELMPDNGICAKLYQPEEVTLEFASNAQQAVGGSSFNFLLGS
QNLERLSADRIRVSSLSGLKMSMRLEDSGTGEREWRVSKVNGVLLGKDESIIFDRAILGE
IQDPRFSLIKDPVLAKLQQLHQINLLDDEPAASDDGRKAGQQPLSQTEDTHEEEDLEELD
ADLLQDLLAKAELPPVASPRVSVPAFGPALQPGDKPNSSHPHRAGAAPLPAHIIPPRAPR
IPEFGPVPIEHFPWSTIYAAGTACDAVLPDSAPRDHQVIVIRRGGCNFSTKLANIPAFSP
SFRSLQLVVVVSDDDGAESSSAAHLREQAGLIRPLLDEVQVTPAGFARRHPIPMVMVGGG
DVGYEQLGAAKRMGLARRWFVESSGFRVRNVIVDEGDNDEVD

Enzyme Prediction     

No EC number prediction in XP_001912538.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	89	643	9.9e-138	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	7.42e-130	89	644	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	7.98e-57	71	648	61	522	glycoside hydrolase family 47 protein; Provisional
239039	PA_PoS1_like	2.98e-05	961	1018	11	78	PA_PoS1_like: Protease-associated (PA) domain PoS1-like. This group includes various PA domain-containing proteins similar to Pleurotus ostreatus (Po)S1. PoSl, the main extracellular protease in P. ostreatus is a subtilisin-like serine protease belonging to the peptidase S8 family. Ca2+ and Mn2+ both stimulate the protease activity of (Po)S1. Ca2+ protects PoS1 from autolysis. PoS1 is a monomeric glycoprotein, which may play a role in the regulation of laccases in lignin formation. (Po)S1 participates in the degradation of POXA1b, and in the activation of POXA3, (POXA1b and POXA3 are laccase isoenzymes), but its effect may be indirect. The significance of the PA domain to PoS1 has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP60020.1|GH47	0.0	1	1122	1	1122
CDP22661.1|GH47	0.0	1	1122	1	1157
VBB71678.1|GH47	0.0	1	1122	1	1144
AEO53259.1|GH47	0.0	45	1122	35	1112
AEO70189.1|GH47	0.0	74	1117	1	1023

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	1.82e-32	87	644	10	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	2.00e-32	87	644	15	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	2.06e-32	87	644	15	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	5.78e-32	87	644	93	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	8.39e-32	87	644	10	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	1.67e-118	58	716	11	539	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q925U4|EDEM1_MOUSE	5.05e-114	81	646	124	583	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|Q92611|EDEM1_HUMAN	1.60e-112	81	644	129	586	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|P38888|MNL1_YEAST	6.99e-100	56	646	5	504	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	2.90e-91	80	644	35	478	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999966	0.000054

TMHMM  Annotations     

Start	End
49	71