CAZyme Information: XP_001912276.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001912276.1
• CAZy Family: GT2
• CAZyme Description: Cutinase [Source:UniProtKB/TrEMBL;Acc:B2A9K8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
245	CU633438|CGC13	25437.88	5.8121

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633438:315741-316523(+)

Full Sequence      

MRFLATVAALTGTLVAALPSPLDEIRTRELVESHRQTMETLEARGWKSGAGATANELLDG
GPCPKVIFIYARGSTEGGNLVSFGSLGSPTGVALDAAFGEANVWVQGVGGAYSAGLLDNL
LPEGTTTAAINEMKSLLIRANSLCPQAKIVAGGYSQGAALAGAAISQSSAAIREQIKGVV
LYGWTKNKQNNGKIPNYPADRLRVYCESGDLVCNGSLIVLPAHGTYADEAADEAPKFLIS
RINAS

Enzyme Prediction     

No EC number prediction in XP_001912276.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	62	241	2.2e-36	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	2.24e-56	62	242	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP59755.1|CE5	2.40e-172	1	245	1	245
CDP22399.1|CE5	2.40e-172	1	245	1	245
VBB71393.1|CE5	1.63e-167	1	245	1	242
CAP65625.1|CE5	4.37e-99	1	245	1	236
CDP31619.1|CE5	4.37e-99	1	245	1	236

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CY3_A	7.11e-75	51	242	3	193	Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY3_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY9_A Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9],7CY9_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9]
1CUW_A	1.88e-69	53	244	19	209	Chain A, CUTINASE [Fusarium vanettenii],1CUW_B Chain B, CUTINASE [Fusarium vanettenii]
5AJH_A	1.11e-68	36	245	6	212	Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005],5AJH_B Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005],5AJH_C Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005]
1XZG_A	1.52e-68	39	244	8	209	Chain A, CUTINASE [Fusarium vanettenii]
2CUT_A	2.59e-68	53	244	5	195	CUTINASE, A LIPOLYTIC ENZYME WITH A PREFORMED OXYANION HOLE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96UT0|CUTI2_FUSVN	5.10e-70	1	244	1	226	Cutinase 2 OS=Fusarium vanettenii OX=2747968 GN=CUT2 PE=3 SV=1
sp|Q96US9|CUTI3_FUSVN	2.05e-69	1	244	1	226	Cutinase 3 OS=Fusarium vanettenii OX=2747968 GN=CUT3 PE=3 SV=1
sp|P41744|CUTI_ALTBR	5.80e-69	50	245	14	209	Cutinase OS=Alternaria brassicicola OX=29001 GN=CUTAB1 PE=2 SV=1
sp|P00590|CUTI1_FUSVN	9.19e-68	1	244	1	225	Cutinase 1 OS=Fusarium vanettenii OX=2747968 GN=CUT1 PE=1 SV=1
sp|Q99174|CUTI_FUSSC	5.25e-67	1	244	1	225	Cutinase OS=Fusarium solani subsp. cucurbitae OX=2747967 GN=CUTA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000405	0.999558	CS pos: 17-18. Pr: 0.9740

TMHMM  Annotations     

There is no transmembrane helices in XP_001912276.1.