CAZyme Information: XP_001912252.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001912252.1
• CAZy Family: GT2
• CAZyme Description: Endo-1,4-beta-xylanase [Source:UniProtKB/TrEMBL;Acc:B2A9I4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223	CU633438|CGC14	24062.22	9.0205

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633438:239125-239796(+)

Full Sequence      

MVSFKSLLTATLATGAAAVPFNATEVFESLQARAGTPSSTGNHNGYYYSFWTDNGGTVNY
QNGNGGSYSVNWQNCGNFVGGKGWNPGNSNRVINYSGQFNPQGNGYLAIYGWTRNPLIEY
YIIESFGTYDPSSGATRLGTFNTDGGTYTIAKSTRYNQPSIEGTKTFDQFWSVRTSKRVG
GSVNVGNHFKAWADKGLRLGSHDYQIVATEGYQSSGSASITVS

Enzyme Prediction     

EC	3.2.1.8:61

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	44	221	2.1e-77	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	2.26e-105	44	219	1	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP22374.1|GH11	2.53e-163	1	223	1	223
CAP59731.1|GH11	2.53e-163	1	223	1	223
VBB71367.1|GH11	1.03e-162	1	223	1	223
BAA08649.1|GH11|3.2.1.8	1.56e-115	1	223	1	219
ACR92587.1|GH11|3.2.1.8	1.56e-115	1	223	1	219

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H1A_A	2.95e-96	36	222	4	190	Chain A, Endo-1,4-beta-xylanase [Thermochaetoides thermophila],1H1A_B Chain B, Endo-1,4-beta-xylanase [Thermochaetoides thermophila]
1XNK_A	3.49e-96	36	222	4	190	Chain A, endoxylanase 11A [Thermochaetoides thermophila],1XNK_B Chain B, endoxylanase 11A [Thermochaetoides thermophila]
6Y0H_A	1.10e-89	29	223	1	193	High resolution structure of GH11 xylanase from Nectria haematococca [Fusarium vanettenii 77-13-4]
1TE1_B	2.31e-88	36	223	4	190	Crystal structure of family 11 xylanase in complex with inhibitor (XIP-I) [Talaromyces funiculosus]
4XQD_A	9.07e-88	40	223	6	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQD_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],5ZF3_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],5ZH0_A Crystal Structures of Endo-beta-1,4-xylanase II [Trichoderma reesei RUT C-30],5ZO0_A Neutron structure of xylanase at pD5.4 [Trichoderma reesei RUT C-30]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WG11|XYNA_ASPFU	8.93e-108	1	222	1	227	Endo-1,4-beta-xylanase xynf11a OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xlnA PE=1 SV=1
sp|B0XXF3|XYNA_ASPFC	8.93e-108	1	222	1	227	Probable endo-1,4-beta-xylanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xlnA PE=3 SV=1
sp|A1DJ52|XYNA_NEOFI	2.56e-107	1	222	1	227	Probable endo-1,4-beta-xylanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xlnA PE=3 SV=1
sp|P55332|XYNA_EMENI	3.99e-101	1	222	1	224	Endo-1,4-beta-xylanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xlnA PE=1 SV=1
sp|B8NKE9|XYNA_ASPFN	2.06e-100	1	222	1	231	Probable endo-1,4-beta-xylanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xlnA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000656	0.999305	CS pos: 33-34. Pr: 0.3503

TMHMM  Annotations     

There is no transmembrane helices in XP_001912252.1.