CAZyme Information: XP_001912227.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001912227.1
• CAZy Family: GT2
• CAZyme Description: Podospora anserina S mat+ genomic DNA chromosome 1, supercontig 1 [Source:UniProtKB/TrEMBL;Acc:B2A9F9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615	CU633438|CGC16	67000.55	8.6763

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633438:166267-168349(-)

Full Sequence      

MRLCGVIQVSCFAGLFPASIQAIKETYDYVIVGGGTAGLTVGDRLSESGKLGLYPCCVLT
LMTEPDGQRPGTLYNITSAPVAGLNNKTFPVSIGCVVGGSSAVNGMVFQRGNAKDYDVWG
ELGGGNPRVRWNWVDMLKYFKKSIQMTAPKPETAAFDLRYDTKYWGRNLTTNHTIFATFG
NQLNSSLLSDAFYEAAKRLSGMKVSPDAGSGQLGLQYYQTSTNPYTGERSYSRTGHWDGL
NRANYDLLTATRANKIVFDHHRAAGVQIYPRGESTKKTTIRARKEVILAAGAIHTPQILQ
LSGIGPADLLKRAGIPVKVDLPGVGYNFQDHTFIPAVSFSWLTSPLIPEHLNITVVDDGL
GKTSLGLSVELPVVSPGSFKRIASKYESQDPATYLPKDTDRTIIRGYRKQQQIYAREMRA
KDFSFLRATFSGDPSFVPIIIHPVSRGTVLIDPAAGSDIEVEPIVNYRAASNPIDVDVAV
EEIKFLRRFMTTGELSRYNATEVVPGPGLESDEALGAWVRANTIPSVYHPVGTAAKMPRE
WGGVVGEDLMVYGVRGLSVVDASMMPTIVAGTTSMTVYAVAEKVRIDLDFFLLNLQADKR
EQAADLIKLRAGTIV

Enzyme Prediction     

No EC number prediction in XP_001912227.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	26	584	7.6e-139	0.9841549295774648

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.86e-80	25	611	4	535	choline dehydrogenase; Validated
225186	BetA	3.06e-79	22	584	3	529	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	4.70e-39	28	584	2	482	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	6.32e-29	27	332	1	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	7.25e-29	443	583	1	142	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP22349.1|AA3_2	0.0	1	615	1	604
VBB71339.1|AA3_2	0.0	1	615	1	613
VBB78527.1|AA3_2	9.10e-181	25	615	34	621
AEO58401.1|AA3_2	7.58e-140	21	611	41	635
CDP31727.1|AA3_2	2.61e-138	21	584	78	618

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	3.97e-90	9	583	9	633	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	1.74e-82	23	583	2	577	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	3.17e-51	26	583	5	559	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	5.21e-49	25	583	15	582	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5OC1_A	8.50e-42	27	583	2	556	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	6.38e-88	1	583	13	608	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.47e-59	8	583	23	624	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	1.39e-57	25	582	45	609	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.39e-57	25	582	45	609	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|Q5B8A1|PKFF_EMENI	2.72e-53	24	584	38	603	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.731948	0.268070

TMHMM  Annotations     

There is no transmembrane helices in XP_001912227.1.