CAZyme Information: XP_001911961.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001911961.1
• CAZy Family: GT15
• CAZyme Description: Mannan endo-1,6-alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:B2B7L1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		41299.82	4.9695

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU640366:3983836-3985006(-)

Full Sequence      

MVISDEGHFRESRRRRNPFGLTKYYTGHLPGDTPGNLPDPYFWWEAGAMFGTLIDYWQLT
GDDTYNDITKQAILHQAAPTRDFMPRNQTRTLGNDDQGFWAMTAMTAAELKFPDPGPDQP
QYLALAQAVFNQWAQRWEENESSGCGGGLPWQIFRFNRGFNYRNSISNGCFFNIASRLAR
FTGNVTYAEWAAKIYTWQEETGLFRDGDVLDGVTVKPEEGNSCDSIDEIQWTYNAGIFIH
GSAVMYNFTDGNPIWKRRLDSHLASAERTFFTNSTDGERVMFEQFCEPPGFCDIDQRSFK
GYLTRWLARTTQLAPYTFESISPLLTNSAIAAAKACSGSPTEAPPGEQPFRGRPGTAGSA
GQRGGMTG

Enzyme Prediction     

No EC number prediction in XP_001911961.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	20	339	1.7e-98	0.8128491620111732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	5.85e-158	19	338	11	319	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	4.18e-07	34	239	32	215	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP73789.1|GH76	8.44e-287	1	368	1	368
CDP26190.1|GH76	5.24e-263	19	357	37	375
VBB76277.1|GH76	5.24e-263	19	357	37	375
AEO56838.1|GH76	3.52e-160	1	357	22	366
AEO63329.1|GH76	3.65e-158	1	357	22	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.13e-97	19	341	45	365	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	2.88e-103	19	338	38	346	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	4.04e-101	19	338	41	349	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	1.88e-97	20	338	40	346	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	4.95e-94	20	338	42	351	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q05031|DFG5_YEAST	5.39e-89	20	338	47	356	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997505	0.002554

TMHMM  Annotations     

There is no transmembrane helices in XP_001911961.1.