CAZyme Information: XP_001911180.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001911180.1
• CAZy Family: GH72|CBM43
• CAZyme Description: Beta-xylanase [Source:UniProtKB/TrEMBL;Acc:B2B5D0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	CU640366|CGC15	45182.86	4.8097

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU640366:1618200-1619429(-)

Full Sequence      

MTRISVLLTTTLLATTTIAQSNREPPSTGLHSLFLSAGKLYFGTATETNNFADPTYQNIL
SNPLEFGQLTPENSQKWGLIQPQPGDFSFNASDQVASLANSYNHLLRCHTLTWHSQLPPF
VSSTSWTPDTLRQLITTHITSVISHFGSACYAWDVVNEALNENGTFRNSVFFNVLGEEYI
AHSFEVAREVAPPETKLYYNDFNLETAPEKQTAAVELVKSLQSKGVKIDGVGLQAHFTVG
QTPSVESLIATLQRFADLGVDVAWTELDVAQEDVETASELAVEQQASDYVVAVRACLEVE
RCVGVTVWQFTDRYSWVPGTFPGKGGACLWTEDYQRKPAYWAVKRFLEGWVARMNVTRAF
VGGNETTVRTVASPRGPLTEVTSGSERLEGSLVKVAFISFGVWLVLNMM

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	35	344	1.9e-96	0.9702970297029703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	5.04e-131	30	344	1	309	Glycosyl hydrolase family 10.
214750	Glyco_10	2.42e-107	76	343	2	263	Glycosyl hydrolase family 10.
226217	XynA	1.31e-81	65	349	57	343	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP73005.1|GH10	7.25e-302	1	409	1	409
CDP25405.1|GH10	7.25e-302	1	409	1	409
VBB75482.1|GH10	2.89e-290	1	409	1	410
AEO63155.1|GH10	9.05e-130	12	349	15	350
AUS45856.1|GH10	7.15e-120	29	347	26	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	1.09e-107	29	340	2	310	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	1.09e-99	29	357	24	342	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3U7B_A	8.05e-99	27	340	2	317	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]
3WUF_A	5.45e-93	41	343	15	308	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	1.40e-90	41	343	15	308	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G4MLU0|XYN5_MAGO7	1.11e-117	1	347	1	353	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1
sp|Q8J1Y4|XYN5_MAGGR	1.11e-117	1	347	1	353	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1
sp|Q5ZNB1|XYND_TALFU	4.00e-102	30	343	21	330	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|P79046|XYN1_HUMGT	2.23e-101	25	347	16	337	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1
sp|O60206|XLNA_AGABI	1.10e-99	30	350	19	331	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999751	CS pos: 19-20. Pr: 0.9838

TMHMM  Annotations     

There is no transmembrane helices in XP_001911180.1.