CAZyme Information: XP_001910902.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001910902.1
• CAZy Family: GH71|GH71|CBM24
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:B2B4K2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770		80553.34	3.7131

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU640366:651175-653729(+)

Full Sequence      

MAPSFSKLGAFALALASGVTATQKYVLSEEYTPSNLFENFEFMEFKGNDEDPNRGHVRYQ
SQADALQLGLIDPVNTDDVFIGVDYTKWAEHGRESVRIESLNSYSKGLFIAEFTHLPKAV
CGAWPAFWLTGEQWPTHGEIDIYEGWNLNPQNKVVGHTEVKTAGVCKIDTDVSSGFVHYP
DCDVVAEGQPTNAGCALDEGNNLFGNPNGGIWATEWTETTFKVWSWARGAEPRDVASGSP
DPLSWGPPSFALTLKSCDVRSAFKDMRMVLNINFSSQFDTCYEYVRDHGADFEDVFWKVK
GISVYQLEDAATSTSTTVSSTTSTTQTVTSAEPTVTETASETVSEEPTSTITSDSEEPTA
TETATETATESAAESATETASETVTETTSESATETVEVTTTSETATTTDGPEPTLTTEAP
ETTTTASPGDEDEDDVCSDDEEETTTTDIATATETETAEPTGEPTETAEPSAEPTDAETT
GVDPTETAVPTETGSDEVTTTAQEFTTSTIFATETFTVTSCAPSVTSCPGRVVTSVIAIG
TTVCPVTPTVTATPEPTETATLPDGWTTSTVYATEVITVSSCPPTVVDCPSRVVTSIVAV
GTTVCPIGSATVPGESVPTDVPTVGVPGEGVPTDGIPVEGVPTDVPTGGVPTGGIPNIDT
TLTTLLTSTGTRTVTLTGGVEQSTSVPPVVVPVPTGGAPINSGNNGTFVPQPPTKPAYTY
SPEVTLPLVPINEQIPAPGPTKLPIVEVNGAGRMVVGGLMGVVAALALVL

Enzyme Prediction     

No EC number prediction in XP_001910902.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	74	278	1.8e-58	0.8908296943231441

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185690	GH16_fungal_Lam16A_glucanase	3.47e-98	24	306	1	293	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
185693	GH16_laminarinase_like	7.34e-09	75	224	54	175	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
395585	Glyco_hydro_16	1.79e-04	122	142	47	67	Glycosyl hydrolases family 16.
185691	GH16_Strep_laminarinase_like	2.08e-04	122	175	106	166	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
236766	rne	6.47e-04	463	631	857	1010	ribonuclease E; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP72727.1|GH16_1	0.0	1	770	1	770
CDP25124.1|GH16_1	0.0	1	770	1	789
VBB75194.1|GH16_1	0.0	1	770	1	801
AEO62381.1|GH16_1	2.97e-91	1	308	1	320
AEO55983.1|GH16_1	8.40e-91	1	315	1	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WDU_A	5.79e-50	25	305	2	295	The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_B The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_C The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_D The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila']
3WDT_A	5.95e-50	25	305	3	296	The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_B The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_C The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_D The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDV_A The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_B The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_C The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_D The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDY_A	3.83e-49	25	305	1	294	The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_B The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_C The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_D The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDW_A	4.05e-49	25	305	3	296	The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDW_B The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDX_A The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila'],3WDX_B The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila']
5JVV_A	3.36e-43	23	305	1	297	Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila'],5JVV_B Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AJR9|EGLX_ARTBC	2.73e-55	14	315	11	324	Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04519 PE=3 SV=1
sp|B0XTU6|EGLX_ASPFC	1.44e-50	1	315	1	336	Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_029980 PE=3 SV=1
sp|Q4X084|EGLX_ASPFU	1.44e-50	1	315	1	336	Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_2G14360 PE=3 SV=1
sp|A1DHY9|EGLX_NEOFI	4.24e-49	1	315	1	336	Probable endo-1,3(4)-beta-glucanase NFIA_089530 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_089530 PE=3 SV=1
sp|B8N7S7|EGLX_ASPFN	4.88e-45	13	306	13	326	Probable endo-1,3(4)-beta-glucanase AFLA_105200 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_105200 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.264836	0.735142	CS pos: 21-22. Pr: 0.6719

TMHMM  Annotations     

There is no transmembrane helices in XP_001910902.1.