CAZyme Information: XP_001910537.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001910537.1
• CAZy Family: GH55
• CAZyme Description: Podospora anserina S mat+ genomic DNA chromosome 6, supercontig 2 [Source:UniProtKB/TrEMBL;Acc:B2B3I6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635	CU638744|CGC11	72227.66	8.1810

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU638744:2383488-2385489(-)

Full Sequence      

MIGSGAWGPRQGVGARNHLAADWRGLDLSLALSLSLLPDLVILLLVYPPLLSSTFSFVSR
PHLLLVSSCLVTFAFSLERYIPVGTGVRRCRPTALFQTTAHRLVSQLTTPSTVVWPLSLF
SHVVPPGNHDSFTELTSSFTFARTNIGSPSMMSKLGSPLGSPTLAATTAQFRNRLPTQFR
RCLPIYVAAIILIFFTFNLNLFHSRVREVTSNAAALARPPVPVVAAPTVPITPVGPAQTP
KAVRTEFPRKIWQTWKVNPLRFEERDINTARSWVGKNPDYRYEVLTDDNDMKYVEWHFGP
EGFNRPDIVNFYRDVKAAIVKADLLRYIVMYAEGGLYADIDVEALKPLSKFIPDRYNVKD
IDMVIGVEIDEPDWKDHPILGPKSRSFCQWTFMCKPQLPVMMRLIEQIMTWLNGVAKEQN
VPLADVKLDFDQIISGTGPSAFTTAILAEMDLHKEDPNIKVDWDLFHDLQESKLVSRTLV
LTVEAFAAGQGHSDSGNHDARAALVRHHYHASNWPSRHPRYSHPAYGEVEKCNWNDECVK
TWDKNVEAFAKMTEEEQRKIVAQKEQERKEAAEKAKAEEEKRKKDREEAEKRKKEEEEKK
RKEAEAKKAEAQEAKRKEEEEKRKEEEKKGWLHFS

Enzyme Prediction     

No EC number prediction in XP_001910537.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	268	353	2.1e-19	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.06e-24	189	476	12	310	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.70e-12	264	354	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP31064.1|GT32	0.0	1	573	1	573
CAP71672.1|GT32	0.0	1	573	1	573
VBB84288.1|GT32	3.17e-311	151	573	1	423
AEO66402.1|GT32	7.10e-241	151	571	1	400
AEO60901.1|GT32	1.13e-234	151	564	1	392

PDB Hits     

XP_001910537.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	2.18e-30	247	487	99	349	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.20e-29	246	514	141	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	6.91e-27	246	486	129	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.28e-20	247	507	96	463	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	7.13e-08	247	352	57	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000007	0.000027

TMHMM  Annotations     

Start	End
29	51
61	83
182	204