CAZyme Information: XP_001910384.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001910384.1
• CAZy Family: GH5
• CAZyme Description: Podospora anserina S mat+ genomic DNA chromosome 6, supercontig 2 [Source:UniProtKB/TrEMBL;Acc:B2B333]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556	CU638744|CGC4	62789.77	5.6944

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU638744:1909851-1911589(+)

Full Sequence      

MAQLRWSYLLLPLLAFDYAPASATVGDYANQEPLTHKFDKSACPDYAHYATYPHGPYSKG
PLELPFQRPDPRCRTFQSDAIEKVIKDVTSRMKDPDLARLFENAFPSTTDTTVRFHTDGK
DEKIKKKLQEREKGNSFREDGEWEGPQSFIITGDIIAEWLRDSTNQLKPYQPLALKDPAI
YTLILGAINTQSEYVIQSPYCNAFQPPPISGLPVSMNGQDDTVHPVYEPNVVFECKYELD
SVAHFLALGNEFHKQTNSKEFINPRWRKAVRNVLRVLESQSQPTFDSATGGYRLNEYTFQ
RRTNTGTETLNLQGVGNPLNNGTGLVRSAFRPSDDATIFGFFIPANAQMSVELGRAAAVL
RKTGDGGDRLLAEEMEGYSKRMREGIWEHGVVTHRKYGRVFAYEVDGFGSALMMDDANYP
SLLALPLMGFVGVEDEVYQNTRRMLLEKEGNPYYLKGRDFRGIGGPHIGLQNAWPMSLLV
QARTSGDDEEIRECLGLVLRGSRLGLVHESVDVNWVTSYTRSWFAWANGVFAETVLDLAR
RKPELIFEDGRPYEIS

Enzyme Prediction     

No EC number prediction in XP_001910384.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	94	536	4.4e-158	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	94	536	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	1.80e-158	73	545	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP30915.1|GH125	0.0	1	556	1	556
CAP71519.1|GH125	0.0	1	556	1	556
VBB84114.1|GH125	0.0	1	556	1	556
AEO66735.1|GH125	2.09e-312	1	555	1	550
AEO55165.1|GH125	3.05e-309	1	555	1	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	1.96e-91	68	538	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	1.49e-89	68	538	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	8.68e-89	68	538	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	1.04e-76	79	537	10	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	1.64e-76	79	537	10	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	4.60e-176	42	546	26	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000192	0.999783	CS pos: 23-24. Pr: 0.9697

TMHMM  Annotations     

There is no transmembrane helices in XP_001910384.1.