CAZyme Information: XP_001910293.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001910293.1
• CAZy Family: GH5
• CAZyme Description: Podospora anserina S mat+ genomic DNA chromosome 6, supercontig 2 [Source:UniProtKB/TrEMBL;Acc:B2B2U2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		36282.48	5.7586

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU638744:1628026-1629195(+)

Full Sequence      

MKFNGASRRSHRHFVAIATLIFSTLAMSTPGPVSNGQDGEQRVISDGAKDETQTSREKSS
DKEGTISGFNPPDFELRILALGDSITYGQGSSHGNGYRKYLRDSLRQAGYKVNMVGSKQH
GLMNNNQVGARDKMDQVATIHGLSKHSVKYQPNVILIHAGTFDTLMQNDLYETEYNYSMP
AFGSGSSPWIGGIYQRYAGMVVADHLWVLEPERPQKIVLADMWAVGIGAAEFEVMGRHDF
RSDGIHPNDSGYEKMASIFLRAIIGPGESGFLSPPRDSEHVEDMAETYGDDLDTFTVEAQ
VPSPLTDENVMIYMAARATDMRGTGGQNSR

Enzyme Prediction     

No EC number prediction in XP_001910293.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	76	177	2e-23	0.520618556701031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.86e-12	76	263	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	9.44e-12	78	262	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238865	sialate_O-acetylesterase_like1	2.43e-09	76	263	1	187	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	7.63e-09	80	254	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238860	Lysophospholipase_L1_like	7.26e-07	77	263	2	176	Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP30826.1|CE3	5.17e-246	1	330	1	330
CAP71428.1|CE3	5.17e-246	1	330	1	330
EAA60916.1|CE0	1.57e-26	76	285	40	264
UPK91538.1|CE0	6.03e-26	56	287	37	278
QGI68641.1|CE3	3.45e-25	71	271	47	253

PDB Hits     

XP_001910293.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	6.23e-09	76	265	44	262	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.391770	0.608204	CS pos: 28-29. Pr: 0.5041

TMHMM  Annotations     

There is no transmembrane helices in XP_001910293.1.