CAZyme Information: XP_001909776.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001909776.1
• CAZy Family: GH47
• CAZyme Description: Podospora anserina S mat+ genomic DNA chromosome 3, supercontig 2 [Source:UniProtKB/TrEMBL;Acc:B2B186]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		33710.05	7.9191

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU638743:2756970-2758015(+)

Full Sequence      

MMFKSLLGFAAMAQTAFGASLQQVQNFGNNPTRIQMYIYVPDRVATNPAIIVAVSTWNTP
SCFADCLLTMGVVPQLHPCGGTGQQWFSGTRLPSFADQNGFILIYPSTPNQSNCWDVHNP
ASLTHNGGGDAGGIISMVNYTLDRYNGNREKVYVMGFSSGGMMTNVMAGSYPEVFEAGAA
YSGTAHACFAGAGGATPFSPNQTCAQGLQKTPEQWGAFVRNSYPGYNGRRPRMMITHGNA
DTLVRPQCATEALKQWSNVLGVSLTRQVQGVPSSQFTQHIYGDGTKLQGFFGNGVGHAPS
VDEQTLLRFFGLIA

Enzyme Prediction     

No EC number prediction in XP_001909776.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	72	258	4.6e-22	0.7224669603524229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	1.97e-36	36	270	1	208	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	2.87e-21	6	202	19	207	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	7.62e-20	70	255	16	194	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
395257	Peptidase_S9	8.52e-07	86	273	2	177	Prolyl oligopeptidase family.
224423	DAP2	2.63e-04	80	184	402	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP27505.1|CE1	4.20e-237	1	314	1	314
CAP70910.1|CE1	4.20e-237	1	314	1	314
VBB78227.1|CE1	1.53e-211	1	314	1	292
AFU88756.1|CE1	6.34e-165	1	313	1	291
QBZ57428.1|CE1	4.05e-161	1	314	1	292

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	4.05e-72	20	311	3	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QND5|FAEB_MYCTT	1.27e-150	1	313	1	291	Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Fae1a PE=1 SV=1
sp|Q9HGR3|FAEB_NEUCR	3.94e-145	4	313	4	291	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|B8M9H9|FAEB_TALSN	2.43e-90	10	312	10	291	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HE18|FAEB_TALFU	1.74e-86	6	312	6	291	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|Q96W96|AXE1_ASPFI	2.72e-73	20	311	31	301	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000350	0.999633	CS pos: 18-19. Pr: 0.9723

TMHMM  Annotations     

There is no transmembrane helices in XP_001909776.1.