CAZyme Information: XP_001909751.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001909751.1
• CAZy Family: GH47
• CAZyme Description: Podospora anserina S mat+ genomic DNA chromosome 3, supercontig 2 [Source:UniProtKB/TrEMBL;Acc:B2B161]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413		42095.04	7.4794

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU638743:2652765-2654006(+)

Full Sequence      

MFSNGFATGAIAFLMAGAQLASAHMEISEPAPFRSKFNPHATNIDYTNTAPLAANGANYP
CKGYHSDLGTAAGAPTASYRPGGSYQFKVTGGAPHGGGSCQVSLSYDKGATFTVIQSIIG
GCPLASSYPFTIPDDAPEGEAIWAWTWNNNIGNREFYMNCAPITISKSAAKREIEAPKVE
QAAVQKRASVGFSSRPALFVANIENGCSVAEGTDVVYPNPGPDVINNGGSTGAPSGNCGP
AGAPAPNPGNGGGDAPAPAPTTTEQAPVVPPTTTAAPVTTKAPASLPGGVFITVPTPDKP
VTSAPVDVPAPQPTTLVISTRPANTPTAAPAPVPTGGAGQQLGYPAGTACQNEGSWNCLG
DGFQRCASGTWSVVQAMASGTKCQMGEGTELLVNKRASRRSFRWRQGSRLQLA

Enzyme Prediction     

No EC number prediction in XP_001909751.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	24	229	7.2e-67	0.9790575916230366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223021	PHA03247	1.12e-04	218	338	2741	2855	large tegument protein UL36; Provisional
236090	PRK07764	6.12e-04	228	348	392	511	DNA polymerase III subunits gamma and tau; Validated
237864	PRK14950	0.001	241	356	361	471	DNA polymerase III subunits gamma and tau; Provisional
237057	PRK12323	0.002	159	362	371	579	DNA polymerase III subunit gamma/tau.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP70884.1|AA11	9.99e-270	1	413	1	413
CDP27480.1|AA11	9.99e-270	1	413	1	413
VBB78175.1|AA11	1.84e-265	1	413	1	413
AEO71776.1|AA11	2.39e-143	1	413	1	414
AEO61991.1|AA11	4.38e-116	1	408	1	412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	8.06e-39	24	221	1	196	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

XP_001909751.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000251	0.999745	CS pos: 23-24. Pr: 0.9757

TMHMM  Annotations     

There is no transmembrane helices in XP_001909751.1.