CAZyme Information: XP_001908917.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001908917.1
• CAZy Family: GH35
• CAZyme Description: Dolichyl-phosphate-mannose--protein mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:B2AYW6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
773		88250.52	9.5587

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633901:1217678-1220115(+)

Full Sequence      

MATTAPQGTLRQRSVAGSKKNKDGASSDVELDKLVKAANQRPKAVSENDHRIAFFIITIL
AFITRFWGISHPNEVVFDEVHFGKFASYYLEKTYFFDVHPPFGKLLFAFVGWLVGFDGHF
HFENIGDSYIANKVPYVAFRSLPALLGALTVSVVYLIMWESGYSLPACILAAGLVLLDNA
HIGQTRLILLDATLVFAMACSLLCYIKFYKLRHEPFSRKWWKWLILTGFALSCDISTKYV
GLFAFITIGSAVVIELWDLLDIKRPGGALTLAQFGKHFAARAFGLIFLPFLFYLFWFQVH
FTILTRSGPGDDFMTPEFQETLSDNIMLSNAITIDYYDTISIKHKETKAYLHSHPERYPL
RYDDGRVSSQGQQVTGYPFNDTNNYWQILPAGADDKQLNRHIKNHDLIRLRHVVTDTILL
SHDVASPYFPTNQEFTTVSLADAYGDRAADTLFEVRIEHGKPNQEWKTISGHFKLIHNPS
KVAMWTHTKPLPEWAFKQQEINGNKQIAPSSNVWLVEDISSLPANHPRRAKVAKKVKTLP
FLRKWFELQRSMFWHNNQLTASHPYASLPYSWPFLLRGVSFWTQNDTRQQIYFLGNPIGW
WIASSVLAIYAGIILADQFSLRRGMDALDHRSRSRLYNSTGFFFLAWATHYFPFYVMGRQ
LFLHHYLPAHLASALVTGALVEFIFSQDAVEHEVAHQAAKAGKKSQTPKHHLTARERFAG
QSLFGSWVATGVILTLVAAGWYFFLPLTYGYPGLTVEQVIRRKWLGYDLHFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	56	301	5.4e-72	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	56	773	29	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	6.99e-84	56	305	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	5.87e-77	543	765	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	1.75e-15	352	501	13	170	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
224720	ArnT	4.84e-08	140	272	87	212	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP23606.1|GT39	0.0	1	773	1	773
CAP69590.1|GT39	0.0	1	773	1	773
VBB72720.1|GT39	0.0	1	773	1	772
AEO65833.1|GT39	0.0	2	773	3	777
AEO54171.1|GT39	0.0	2	773	3	775

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	1.88e-105	57	768	56	728	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	2.95e-89	7	669	20	681	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	9.38e-251	9	773	4	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	7.59e-248	43	765	51	767	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	8.58e-243	47	773	47	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q99PR0|POMT1_RAT	6.56e-113	40	669	28	669	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1
sp|Q8R2R1|POMT1_MOUSE	3.46e-112	40	669	28	669	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999881	0.000123

TMHMM  Annotations     

Start	End
52	69
94	116
137	159
187	209
239	258
278	297
592	614
634	656
723	745