CAZyme Information: XP_001908592.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001908592.1
• CAZy Family: GH3
• CAZyme Description: Podospora anserina S mat+ genomic DNA chromosome 1, supercontig 2 [Source:UniProtKB/TrEMBL;Acc:B2AXZ1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
702	CU633901|CGC8	77728.39	5.2737

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633901:166428-168536(-)

Full Sequence      

MVVPFLTGNRRGRVIGIALLLTVIIFWLGYQSPIATPRQETLDLHAPKVPEHVTPHHHDS
GQVAHPNTNPAGSAEREDDVTEEHGATPTKPETTKVPPAEGDDSDVGLADFGNQFATTEE
AGPAATAKVDCIGFEQLQRQKPGPHSEGKRKFPFVRPPPECRTFRLPALEALLERMKKVI
KDPDLYRLFENSYPNTLDTMVKWRGYANKTVEGGSGEEGSNEVQTVMTDEELTYVITGDI
DAMWLRDSASQIYSYLPLLEPSDKFDSLASLWRGLINSHSRYIVISPYCHSFQPPPESGI
PPTHNGAFHQNNPQPPYNPKLVFDCKWELDSLASFLQISAAYYTRTDDLKFFSRYSWVNA
VEAAVDASAAMRLGTYDEEGHVLPSAWTFTGYTNRGSETLTNDGLGNPVKENGMVRSAFR
PSDDACIFQLLTPSNMMFAAYLEQASAIMEGLAEQKLNPKAANLTTEMRKLAKTIRHGIA
KDAVVKHRDFGEIFAYEVDGYGGANLMDDANVPSLLAFPLWNYTNTKTSTTPRMVKSVNK
SLGARNGTIEKNSEKEKDEEEEAKHDYAKIYQNTRKFVLSMANPYYAKGPALSAVGGPHL
GPGKGWPMAATVAALTAFEDLAGFSDEERGRVVGEQMLMVLNSTSGAGVIHETVNAWREF
DFTRSWFGWANGLFGELILKIAEDEERRGVGEKGLLGRLYQE

Enzyme Prediction     

No EC number prediction in XP_001908592.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	182	679	5.7e-168	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	182	679	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	1.02e-125	161	683	2	424	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP69265.1|GH125	0.0	1	702	1	702
CDP23284.1|GH125	0.0	1	702	1	702
VBB72383.1|GH125	0.0	1	702	1	702
AEO53412.1|GH125	1.44e-316	1	702	1	756
AEO70287.1|GH125	9.11e-313	5	702	5	718

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3P2C_A	5.00e-71	156	684	21	453	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	7.10e-70	156	684	43	471	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	6.99e-68	156	684	23	451	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3QT3_A	5.68e-58	180	678	23	419	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
6RQK_A	1.29e-56	180	678	23	419	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.15e-97	148	683	43	498	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999210	0.000817

TMHMM  Annotations     

Start	End
12	34