CAZyme Information: XP_001908470.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001908470.1
• CAZy Family: GH2|GH2
• CAZyme Description: Cellulase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:B2AXL9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433	CU633900|CGC7	48589.97	6.2298

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633900:3221400-3222701(-)

Full Sequence      

MKVLSLLLSLVTGISALPNPLPQDPAPTPGVITPPPLPLSTSSRWILDANNKRVKLRCIN
WAGHLETNIPEGLHRQPLDYITTWIATQNFNCVRLTFSSDLTFSGPTTPVHTSFTTVSQQ
QSRPALINDIYPLIITKNPWITPNTTTLDVFAAVVDTLWSKGIITILDNHVSKASWCCNL
TDGNGWWDTASGYNPFNSRFFSTSSWLSSLAFMATWAKSHPGVVGLGLRNELRAFLLQDL
NGRRDWYANIQRAGNLVHQANKDLLILVGGAQSSTDLVHLKTRMLDTSGWEGKNVWEMHA
YSFTVTFPDPFKNCDLVKAGYGFWSGFVLEQDRPYTGPLIMSEFGVGMQGSEVDSQYGGL
NEQDHRYLDCLVGYLEGNDAEWAVWAIQGGYYIREGTVDYDETWGLMDREWKGWRNERFR
QKIQGLYAVTQGP

Enzyme Prediction     

No EC number prediction in XP_001908470.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	46	387	3.1e-124	0.9968051118210862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	6.46e-05	135	387	51	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP32623.1|GH5_11	0.0	1	433	1	433
CAP69143.1|GH5_11	0.0	1	433	1	433
VBB87102.1|GH5_11	0.0	1	433	1	433
AEO57401.1|GH5_11	6.61e-188	26	433	16	427
AEO69593.1|GH5_11	5.96e-187	37	433	25	420

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	1.55e-15	41	412	8	337	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	1.55e-15	41	412	8	337	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
4TUF_A	5.11e-06	42	418	5	336	Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_B Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_C Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_D Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C0HLA0|GH5FP_CHAOB	3.36e-68	37	433	29	401	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P54583|GUN1_ACIC1	1.78e-14	41	412	49	378	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999716	CS pos: 16-17. Pr: 0.9825

TMHMM  Annotations     

There is no transmembrane helices in XP_001908470.1.