CAZyme Information: XP_001908385.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001908385.1
• CAZy Family: GH24
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:B2AXD4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613		70575.06	7.7724

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633900:2911727-2913637(+)

Full Sequence      

MRNRQIGVLGALLFLVFCVYSLSRSPGGLPRPRSPQKEPEDKPPEPPRIAIPITWTDDSN
TKDTKPAPAPEGSHPIWYLTNQAEKEFEVVKGRQSRTLGEAVGEYKRRYGIPPPPNFDKW
WDFATERGVVLVDEFDTVMELVTPFWGLKPATTRRRAREVIGFDDSLMGVQIRKGNVTSV
FKARTAEWHQRGVLGMLEKFVGWLPDMDLAFNVNDESRVVVPFEDLERLVKVGLGVNMAK
LKREKEPRNGWTDVGKVEGLDYEGRFDEGKLTRFNTFAHQPTWTHSRISCPPGSPARILE
EGEQFDDRGRYSMGELGFVTNWTAMADICLTPSLQSTFGFFDRPNAYSVVHDLVPVFSPS
KISSYQDLIFPSPWYYSGKVPYDPKKDPDWEEKMNRLYWRGSTTGGFSRNGGWRRQHRQR
VVKKFNAVDKANVLTNVGSSTSPNWTVASVPRGDYKSLLDVYFSHKGQCDPGDCAAQKEF
FEIKEYAKQEDALKYKHVLDMDGNAFSGRFHAFLKSKSLVFKFAIFKEWHYEWLRPWAHY
VPMSLKGEEWLELVRYFGEEGEGKREGERVAMQGREWAGKVLRGEDMEVWFFRLLLEYGR
VVDDDREKIGFDM

Enzyme Prediction     

No EC number prediction in XP_001908385.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	332	602	2.1e-79	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	4.36e-16	351	600	28	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	4.21e-05	355	600	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP69058.1|GT90	0.0	1	613	1	613
CDP32535.1|GT90	0.0	1	613	1	613
VBB87010.1|GT90	0.0	1	613	1	613
EAA28085.1|GT90	1.13e-270	1	611	1	617
AEO69478.1|GT90	6.74e-262	1	611	1	724

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.57e-08	355	602	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	1.70e-07	332	600	95	340	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	9.99e-51	73	607	151	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	1.60e-10	354	602	162	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	2.13e-10	354	602	163	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q7ZVE6|PLGT2_DANRE	2.51e-08	388	601	295	465	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|Q6UW63|PLGT2_HUMAN	3.32e-08	427	601	284	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995785	0.004251

TMHMM  Annotations     

Start	End
7	24