CAZyme Information: XP_001907754.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001907754.1
• CAZy Family: GH18
• CAZyme Description: CBM1 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:B2AVK3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
826		88101.78	6.4967

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633900:787733-790293(+)

Full Sequence      

MRSASRFLGALAAVASLPSAFGQNNVPNTFTDAETGIVFNSWGIPNGSPQSQGGWTFGMA
LPSDALSTDATEFIGYLDAAGWCGFSLAGPMTNSLLITAWPHEDTVYTTLRYAGGYAMPD
KYAGNAEITQIRSSQNSTHFSLVFRCKNCLQWDHNGSTGGASTSGGFLVLGWVQAFPSPG
NPTCPDQITLEQHDNGMGIWGAVLDENVANPSYTAWAAQATKTVTGDCGGPVETGIIGVP
VPTGTAFDYIVVGGGAGGIPTADKLSESGKSVLLIEKGIASTGEHGGTLKPKWLEGTQLT
RFDVPGLCNQIWVDSNGIACTDTDQMAGCVLGGGTAINAGLWFKPYSLDWDYLFPTGWKA
KDVAGAISRVFSRIPGTDTPSQDGQRYLQQGFNVLAGGLRAAGWQQVTANNAPDRKNRTF
SNTPYMFSGGQRGGPLATYLRTAKTRPNFNLWLNTVVKRVIRTDGHITAVEVEPFRDGGY
KGIVKVKDVTGRVVLSAGTFGSAKILLRSGIGPADQLEIVKNSVLDGPDFINNASWINLP
VGYNLDDHLNTDTVISHNNVGPAFYDFYQAWTAPNTTDANKYLSSRSGILAQSAPNIGPM
FWEEIKGADGKVRQLQWTARVEGSFDVPNGYAMTMSQYLGRGATSRGRMTITPSLTTIVS
DVPYLKDPNDKEAVITGLNNLRAALNNVQGLTWNYPPASMSSREYVDAIPVTPGVRRANH
WMGTNKIGTDDGRLGGTAVVDLNTKVYGTDNLFVVDASIFPGTPATNPSSYIVTAAEHAS
AKILALPPAQVNAKWAQCGGKNWTGSFQCAAGSTCQRQNDWYSQCL

Enzyme Prediction     

EC	1.1.99.18:13	1.1.99.18:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	241	786	4.7e-241	0.9762773722627737
AA8	30	216	1e-64	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	8.35e-68	30	212	1	177	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
187688	CDH_like_cytochrome	3.65e-41	29	204	1	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
225186	BetA	1.37e-38	247	791	8	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.57e-25	644	779	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	6.11e-19	439	791	206	542	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP68427.1|AA3_1|AA8|CBM1	0.0	1	826	1	826
CDP31900.1|AA3_1|AA8|CBM1	0.0	1	826	1	826
VBB86384.1|AA3_1|AA8|CBM1	0.0	1	826	1	831
ADT70773.1|AA3_1|AA8|CBM1|1.1.99.18	0.0	1	826	1	831
ABS45567.2|AA3_1|AA8|CBM1|1.1.99.18	0.0	1	826	1	828

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	0.0	27	826	4	806	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI4_A	0.0	240	826	1	585	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	0.0	24	826	2	807	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1KDG_A	7.78e-123	240	786	1	542	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
1NAA_A	3.67e-122	245	786	1	537	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	4.22e-151	20	786	16	769	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|B3PTE0|BETA_RHIE6	7.78e-21	248	788	4	530	Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CIAT 652) OX=491916 GN=betA PE=3 SV=1
sp|C3MIE4|BETA_SINFN	1.03e-20	248	796	4	545	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=betA PE=3 SV=1
sp|Q1MJU4|BETA_RHIL3	1.03e-20	248	788	4	530	Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) OX=216596 GN=betA PE=3 SV=1
sp|Q2KB43|BETA_RHIEC	9.93e-20	248	788	4	530	Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) OX=347834 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000336	0.999619	CS pos: 22-23. Pr: 0.9767

TMHMM  Annotations     

There is no transmembrane helices in XP_001907754.1.