CAZyme Information: XP_001907680.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001907680.1
• CAZy Family: GH18
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:B2AVC9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651		74125.21	8.4201

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633900:542423-544607(-)

Full Sequence      

MAPRQDQLRPGIPETPSSSLSLATPDPFRDPSDVDSSAQSASSRRTSGDLPVADVTPPAR
ALTRPPPTQTIKGETITAALPQEEVFNEKAGADVEKGTQPVAFSSTDAEKAGEETAATPR
KKSRNPFKRLYERFRETYCPREEPGLVFPTGPTDEEKMMYLHTNRIPLYIFGLFSFFTLS
AGMWLFSVCAPIFAWYGVFVGFLNVYLIISYFVGVVGKDWDYKGHRELVEKYPINDETAP
TVDVYLPCCSEPLEIIENTYQHVIKLDWPAAKLKVYVLDDGDQPAIKALAEKYGFNYIVR
EDRPRLRKAGNLRWAFTRTEGEFFAIFDADFCPRPDFLKELVVEHMADPKTAIIQSPQFF
RVTDDQTWVEQGAGATQELFYRVVQVNRNKWGASICVGSNAVYRREALVEVGGTAEIGFS
EDVHTGFGAVDRGWKVKYVPLCLATGICPNTPRSFFSQQMRWARGSTTLLTTKHFWTSNL
SFIQKVCYLCGLLYYSAVSLGIFISPIPGTLLLIFRPEWFKYYNLAFAIPSIIYGSLLFR
FWAKAKYGFNVQHVMIVQSYAYLTAIKDRLFGIELLWAASGDKKAHKKSNKFRNMRLLCW
FWTILTIGGVISAVTYRLKNDFPWYHTLPLLILNGYNLYIVHYFLFCSWRW

Enzyme Prediction     

No EC number prediction in XP_001907680.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	244	411	3.9e-26	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	1.77e-104	240	470	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	1.47e-43	184	542	1	361	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	2.71e-43	233	537	253	562	cellulose synthase catalytic subunit; Provisional
133045	CESA_like	4.44e-34	244	422	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133059	CESA_CaSu_A2	4.74e-34	240	466	1	232	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP68353.1|GT2	0.0	1	651	1	651
CDP31824.1|GT2	0.0	1	651	1	651
VBB86309.1|GT2	0.0	1	651	1	651
AEO69079.1|GH12|GT2	0.0	8	634	242	874
AGY80099.1|GH12|GT2	0.0	127	651	361	884

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.02e-35	240	537	273	575	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	1.65e-32	233	489	121	399	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.03e-32	233	489	133	411	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	2.03e-32	233	489	134	412	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P58931|BCSA_PSEFS	1.74e-41	195	537	113	461	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
sp|Q9RBJ2|BCSA4_KOMXY	2.58e-38	231	544	135	464	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
sp|Q9WX75|BCSA5_KOMXY	2.58e-38	231	544	135	464	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
sp|P0CW87|ACSA1_KOMXY	2.61e-38	233	505	142	418	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
sp|P58932|BCSA_XANAC	6.92e-38	233	495	146	411	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

Start	End
166	188
192	214
492	514
524	543
597	614
624	646