CAZyme Information: XP_001907658.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001907658.1
• CAZy Family: GT62
• CAZyme Description: CBM1 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:B2AVA7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445	CU633900|CGC3	48880.62	7.6675

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633900:472790-474183(+)

Full Sequence      

MADRPSRGERSRVVSRQGASRISHFIELGIPNLTIKMHSRNVLAAAVALAGAPSVHAVLR
FSCSELVTERLDPLVFPGAMQSPHVHQIVGGNMFNVTMDPNRHNIGEEATCTTCTFSEDF
SNYWTAILYFRARNGTLIRVPQRPNIDFDGARGGGMTVYYTATYQNHKPTAFQPGFRMIV
GNPMYRTQAEASRYRQMTFTCLETLSTRTGETTEMPKQPCREGIMSNVRFPTCWDGKTLD
PPDHSSHVAYPSSGTFESGGPCPASHPVRIPQLFYEVLWDTRRFNDRSLWPEDGSQPFVW
SYGDYTGYGTHGDYVFGWKGDSLQRAMDANCDFYCPQLKTQSIATGNQCRQNQKVAENID
GPFDRLPGNVEITGPQPGASNPNPGNGGGSTQTPVQPTPVPNPGNGGGCSVQKWGQCGGQ
GWSGCTVCASGSTCRAQNQWYSQCL

Enzyme Prediction     

No EC number prediction in XP_001907658.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401346	DUF1996	1.31e-120	72	318	1	234	Domain of unknown function (DUF1996). This family of proteins are functionally uncharacterized.
395595	CBM_1	1.20e-13	413	441	1	29	Fungal cellulose binding domain.
197593	fCBD	1.84e-12	413	445	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP31801.1|CBM1	0.0	1	445	1	445
CAP68330.1|CBM1	0.0	1	445	1	445
VBB86287.1|CBM1	0.0	1	445	1	445
CBX32766.1|CBM1	1.45e-315	37	445	1	409
AEO58207.1|CBM1	3.41e-212	40	445	51	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MVI_A	1.65e-10	384	444	234	292	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
4BMF_A	1.73e-09	409	445	2	38	Chain A, ENDOGLUCANASE EG-1 [Trichoderma reesei]
4QI4_A	3.82e-08	411	445	551	585	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	4.40e-08	411	445	773	807	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
5X39_A	9.77e-08	410	445	1	36	Chain A, Exoglucanase 1 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2ABX7|CEL6A_PODAN	8.17e-10	414	445	31	62	1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6A PE=1 SV=1
sp|Q99034|AXE1_HYPJE	2.26e-08	378	445	240	302	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|E7EF85|XYNB_PENOX	2.39e-08	409	445	276	310	Endo-1,4-beta-xylanase B OS=Penicillium oxalicum OX=69781 GN=xynB PE=1 SV=1
sp|G4MPQ7|XYN6_MAGO7	2.49e-08	414	445	22	53	Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL6 PE=3 SV=1
sp|Q8NJ73|XYN6_MAGGR	2.49e-08	414	445	22	53	Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea OX=148305 GN=XYL6 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in XP_001907658.1.