CAZyme Information: XP_001907646.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001907646.1
• CAZy Family: GH18
• CAZyme Description: Podospora anserina S mat+ genomic DNA chromosome 7, supercontig 1 [Source:UniProtKB/TrEMBL;Acc:B2AV95]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		42235.69	9.7798

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633900:438259-439436(+)

Full Sequence      

MGLLPLHHTRHHSTPTSKTPRSSRTSSPSTRRRSGIILQRIACLLITVAIVGLWCARDLV
YDSYTLAALPLLKWRQGASSFYLSVENDGFDVTFESYDVNQTSTRGEEGYEDRVPGILHH
IALGPQENQKEGWQEARERCVELHPGWEAMLWTDEKADELVREHYPEMLGLWEGEDGYRY
GIQKVDALRYMVLYRYGGVILDMDLQCKRALGPLRRFDFVAPAANPTGFSIGFMMAEKGN
EFVGELVANLKRYNRHWLGLPYPTVMFSTGCHYASTIHAFFRGDRSKLKILGGTKDNKKL
HMLSGPVNTPLFKHLGSSSWHSYDAAMIVNLGKSVGGSRWRLPIMFLLACGLFFLVIRRI
RRRRRVASLKV

Enzyme Prediction     

No EC number prediction in XP_001907646.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	133	214	1.3e-17	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.88e-20	131	270	97	232	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.44e-14	131	214	2	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP31789.1|GT32	7.76e-280	1	371	1	371
CAP68318.1|GT32	7.76e-280	1	371	1	371
VBB86275.1|GT32	5.03e-276	1	371	1	371
AEO68738.1|GT32	2.26e-139	41	364	18	329
QLI72858.1|GT32	6.54e-118	31	335	8	300

PDB Hits     

XP_001907646.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	2.53e-33	100	365	53	303	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P33300|SUR1_YEAST	4.20e-31	114	335	55	266	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.86e-29	114	335	62	274	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	2.56e-29	114	328	57	262	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	5.94e-24	114	329	82	290	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999962	0.000059

TMHMM  Annotations     

Start	End
36	55
258	280
340	357