CAZyme Information: XP_001907571.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001907571.1
• CAZy Family: GH18
• CAZyme Description: Beta-xylanase [Source:UniProtKB/TrEMBL;Acc:B2AV20]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	CU633900|CGC6	41337.15	8.6303

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633900:225448-226737(-)

Full Sequence      

MHLPTAASLLLSALPLAVATPTPGHGHKEKGLNTYAKEAGLKYFGAATDSPGFRERAGYE
AQYPKYDQIMWKSDEFGQTTPTNGQKWLFTEPQQGVFNYTEGNIVTSLAKKHGKYLRCHA
LVWHSQLAPWVEAKTDWTKDELRAVIVNHVTRVAKAWKGQCYAWDVVNEALEEDGSYRKS
VFYNVLGEEYIKLAFATAAKVDPKAKLYYNDYNLEWPHAKTEGTQRIVKMLQKAKIRIDG
VGLQAHLIAEQAPTLDQHIDAIKGFTKLGVEVALTELDIRLQVPANATNLAQQKEAYKNA
VGACVQVKGCIGVTIWDFYDPFSWVPYVFPGEGAPLLWFEDWSKHPAYYGVQEALKNGTK
KGKPGKWW

Enzyme Prediction     

EC	3.2.1.8:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	34	353	3.7e-89	0.9834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	1.48e-112	32	351	1	308	Glycosyl hydrolase family 10.
214750	Glyco_10	3.32e-98	86	351	2	263	Glycosyl hydrolase family 10.
226217	XynA	2.40e-64	75	355	57	341	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP68243.1|GH10	4.69e-284	1	368	1	368
VBB86180.1|GH10	4.69e-284	1	368	1	368
CDP31714.1|GH10	4.69e-284	1	368	1	368
AEO58598.1|GH10|3.2.1.8	5.68e-202	1	366	1	365
AHE13927.1|GH10	7.35e-197	1	363	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	4.71e-119	31	355	2	317	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	1.02e-105	3	351	5	335	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3WUF_A	2.81e-93	38	355	10	312	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3U7B_A	3.12e-93	31	348	4	317	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]
3WUB_A	9.08e-92	38	355	10	312	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ZNB1|XYND_TALFU	3.21e-109	10	359	3	338	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|P79046|XYN1_HUMGT	1.80e-97	32	355	21	337	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1
sp|I1RQU5|XYN1_GIBZE	5.17e-95	31	348	20	333	Endo-1,4-beta-xylanase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYL1 PE=1 SV=1
sp|B3A0S5|XYNA_FUSO4	1.60e-92	31	348	4	317	Endo-1,4-beta-xylanase A OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) OX=426428 GN=FOXG_17421 PE=1 SV=1
sp|Q2PGV8|XYN2_AURPU	5.33e-91	1	360	1	360	Endo-1,4-beta-xylanase 2 OS=Aureobasidium pullulans OX=5580 GN=xynII PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000315	0.999671	CS pos: 19-20. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in XP_001907571.1.