CAZyme Information: XP_001906834.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001906834.1
• CAZy Family: GH135
• CAZyme Description: Podospora anserina S mat+ genomic DNA chromosome 6, supercontig 1 [Source:UniProtKB/TrEMBL;Acc:B2ASY2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
269		28760.82	7.7115

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633898:138706-139610(+)

Full Sequence      

MKGSTIPLLFAGVTLTAAYPITGDVVNCRSGPGTSYSVVKQYTQGQDVTITCQTEGTNVN
GVTIWDKTADGNCYVSDYYVQTGVNGYVTERCSGACTAPKSNQATVDLIAEFEGFEPNVC
MSSWFDLAVIFKHSDMRGQTSILLEIQPSAMATSVSKLAALRCRIQSRSPRLMRFEQCIT
AMITGATLNLNQYGALISWSFNMGCGAAQTSTLVARLNKGENVNTVLAQELPRWVYGGGV
VLPGLVRRRNAEVALAQTAGSGPALPVQC

Enzyme Prediction     

No EC number prediction in XP_001906834.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	171	252	1.4e-20	0.5693430656934306

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381599	lyz_endolysin_autolysin	2.09e-35	172	255	54	134	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381620	lyz_P1	1.40e-24	172	255	57	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381619	endolysin_R21-like	1.16e-18	171	255	59	140	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
226295	RrrD	1.49e-17	103	255	9	146	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
395766	Phage_lysozyme	1.15e-09	175	249	35	106	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP67505.1|GH24	5.31e-197	1	269	1	269
CDP30368.1|GH24	5.31e-197	1	269	1	269
VBB83567.1|GH24	1.56e-118	1	173	1	173
AEO71812.1|GH24	1.67e-96	1	269	1	261
QKD50435.1|GH24	4.51e-91	1	269	1	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	6.35e-12	172	255	112	192	Chain A, Lysozyme [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07540|ENLYS_BPPZA	9.89e-09	102	255	4	141	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
sp|P11187|ENLYS_BPPH2	3.33e-08	102	255	4	141	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
sp|O07909|YRAI_BACSU	3.79e-07	9	93	19	118	Uncharacterized protein YraI OS=Bacillus subtilis (strain 168) OX=224308 GN=yraI PE=3 SV=2
sp|Q9T1T5|ENLYS_BPAPS	1.19e-06	188	259	73	146	Endolysin OS=Acyrthosiphon pisum secondary endosymbiont phage 1 OX=2682836 GN=13 PE=3 SV=1
sp|O07934|YRAJ_BACSU	4.61e-06	22	93	36	118	Uncharacterized protein YraJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yraJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999758	CS pos: 18-19. Pr: 0.9684

TMHMM  Annotations     

There is no transmembrane helices in XP_001906834.1.