CAZyme Information: XP_001906514.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001906514.1
• CAZy Family: GH115
• CAZyme Description: Podospora anserina S mat+ genomic DNA chromosome 1, supercontig 6 [Source:UniProtKB/TrEMBL;Acc:B2AS12]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679	CU633897|CGC5	75085.06	7.0474

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633897:221547-224200(+)

Full Sequence      

MSPLPEEFDIIVCGGGSTGCVVAGRLANLDHNLKVLLIEAGENNLNNPWVFRPGIFPRNM
KLDSKTATFYESNPSPSLSGRGAIVPAANILGGGSSINFMMYTRASASDYDDFQAKGWSA
EELLPFMKKFETYQRASHNRETHGFEGPIKVSFGNYQYPIKDDFLRAAESQGIPIVDDLQ
DLKTGHGAEQWLKWINRDTGRRSDAAHAYIHATRAVHSNLYLACNTKVDKVIIENGRAVA
VQTVPTKPLGNVSTRIFKARKQIVVSGGTMSSPLILQRSGIGDPAKLRAAGVKPIVDLPG
VGLNFQDHYLTFSLYRAKPGVESFDDFARGDPATQKRVFEEWNLKGTGPLATNGIEAGVK
IRPTLEELKEFESWPTPNFKEGWESYFKNKPDKPVMHYSVIAGWFGDHMLVPPGNYFTMS
VTISLSESHSLMSPYPFSRGKTHITSPDPYAVPDFDAGFMNDPRDMVPMVWGYIKSRETA
RRMDAYAGECQSMHPVFDYDSEARAHDLNLADTNAYALPGNITAGIQHGSWSVPLPEPED
KLTPENIKRIVSSNRKDKRRELKYTKKDIQAIEEWVKRHVETTWHCLGTCSMAPREGNSI
VKHGVLDERLNVHGVKGLKVADLSIAPDNVGANTFTVALTIGEKAAALVAEDLGYSGEAL
EMKVPDYHAPGENRLASRL

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	654	3.3e-246	0.9983050847457627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.77e-78	1	652	1	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.29e-74	6	649	4	531	choline dehydrogenase; Validated
366272	GMC_oxred_N	3.02e-44	76	309	12	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	4.34e-24	436	645	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	8.77e-12	6	307	54	326	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP67183.1|AA3_3	0.0	1	679	1	679
CDP24596.1|AA3_3	0.0	1	679	1	669
VBB73833.1|AA3_3	0.0	1	679	1	669
AEO64928.1|AA3_3	0.0	1	679	1	667
UQC76782.1|AA3_3	0.0	4	679	5	669

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HSA_A	0.0	4	667	3	650	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6H3G_A	2.15e-222	5	670	4	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	3.48e-221	5	670	4	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5OC1_A	4.08e-45	7	652	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.96e-44	7	652	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00922|ALOX_CANBO	0.0	4	667	3	650	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1
sp|C4R702|ALOX2_KOMPG	0.0	4	667	3	650	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1
sp|F2QY27|ALOX1_KOMPC	0.0	4	667	3	650	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1
sp|F2R038|ALOX2_KOMPC	0.0	4	667	3	650	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1
sp|P04842|ALOX1_KOMPG	0.0	4	667	3	650	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in XP_001906514.1.