CAZyme Information: XP_001906447.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001906447.1
• CAZy Family: GH11
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:B2ARU5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		43411.88	6.3047

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633897:11360-12626(+)

Full Sequence      

MWPAEAVIGAISTLLSLQADHVAPGFISSNSTPSWHTSLAKRAAQDFFLRVMPLGASITE
GIGSRNGAGYRDLLRAQLRTRGWNVNMVGSKQNGRFEDSDNEGHPGLTINQVRGEFNKTG
KALMPNLVLLNAGTNDCIRQIDTNNAGARLKALIDDVFTTVPGVTVVVSTLAPSRKNDSC
SADLSQQYRDLVTNTYRGNPRIGMADLHAAININDHLHPDGVHPNDAGYAIFASLWMEAI
RKLEDQIQPPAAVIDDGPADVQRPSPPNDKECIRTPGTVVDGTYLHEQVERGVLSSAKIP
KRLDGREATPSQIFFANVVVMNNLFKRGEELDDRIAVYRGGDGGNRYVLSQNRAGGNFET
NTMEFSVGIDCDVSKGARVIFADFVSTYLVFALWLGGWC

Enzyme Prediction     

No EC number prediction in XP_001906447.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	49	240	1.5e-57	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	6.50e-30	49	240	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.48e-14	54	231	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	2.32e-12	54	239	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
225353	TesA	1.40e-08	54	246	14	214	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
238872	SGNH_hydrolase_like_2	4.89e-08	50	239	3	191	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP24531.1|CE3	2.91e-296	1	399	1	399
CAP67115.1|CE3	2.91e-296	1	399	1	399
CCT73237.1|CE3|GH43_30	7.25e-81	44	384	74	419
AEO70515.1|CE3	2.12e-66	37	372	91	425
BCS30471.1|CE3	2.18e-45	28	246	37	252

PDB Hits     

XP_001906447.1 has no PDB hit.

Swiss-Prot Hits     

XP_001906447.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996356	0.003656

TMHMM  Annotations     

There is no transmembrane helices in XP_001906447.1.