CAZyme Information: XP_001906077.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001906077.1
• CAZy Family: CE5
• CAZyme Description: Pectinesterase [Source:UniProtKB/TrEMBL;Acc:B2ARG5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	CU633895|CGC1	34274.09	9.1207

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633895:1138758-1139824(-)

Full Sequence      

MHLLPLLLPLLGLIPSTAAQARTTPPSSSCIRVSKTPSAHSAQFSTLSSAITSLSTTSTS
PVCIFLYPGTYQEQVLIPAAVKSTISIYGSTTNSASYTSNSVTITQSKSQANTGASNDET
GTVRVKANNVKIYNLNIVNSYGKGSQAVALSAYADSGYYGCSFQGYQDTVLANRGKQYYS
RCEIVGVTDFIFGQESPAWFERSNSASPNFYVFNNCNIAAKSGQSVNNGAFYLGRPWREY
ARVVFQNTTMSGVVNGAGWRIWNAGDERTSNVYFGEYANSGPGAGGTRASFARRLGGPVA
IETVLGGDYKGQGWFDGNYGM

Enzyme Prediction     

No EC number prediction in XP_001906077.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	40	293	1.3e-59	0.9097222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	7.76e-37	62	314	41	291	putative pectinesterase
395871	Pectinesterase	2.50e-36	41	285	9	267	Pectinesterase.
178372	PLN02773	3.23e-35	32	295	5	282	pectinesterase
215357	PLN02665	3.86e-35	31	295	70	340	pectinesterase family protein
215383	PLN02713	1.78e-31	64	288	285	523	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP66743.1|CE8	5.04e-228	1	321	1	321
CDP28478.1|CE8	5.04e-228	1	321	1	321
VBB80096.1|CE8	6.19e-199	1	321	1	339
QBZ62655.1|CE8	4.98e-112	6	319	4	324
QGI88211.1|CE8	3.75e-110	11	319	7	328

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	1.79e-54	20	319	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.52e-54	20	319	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1XG2_A	6.71e-21	44	285	15	270	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.79e-20	41	284	16	273	Pectin methylesterase from Carrot [Daucus carota]
3UW0_A	3.04e-08	33	284	35	335	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	4.35e-78	16	319	14	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	1.80e-68	19	319	17	329	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	1.02e-62	41	319	41	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.02e-62	41	319	41	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	8.06e-62	1	319	1	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000202	0.999774	CS pos: 19-20. Pr: 0.9734

TMHMM  Annotations     

There is no transmembrane helices in XP_001906077.1.