CAZyme Information: XP_001906075.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001906075.1
• CAZy Family: CE5
• CAZyme Description: GPI mannosyltransferase 2 [Source:UniProtKB/TrEMBL;Acc:B2ARG3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463		50012.34	9.5389

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633895:1134016-1135645(+)

Full Sequence      

MTASSPSFKSPRAHAPTTTTITTTTITTPSTRIISSAQPYRTLVTAFLIWKAVLFAIALG
STLVGDAYDTSADLLVHGGVEAATTGQQRAQQPLGLSGGLVSRFASWDAIYFLSSAKRGY
IYEQEWAFGAGLPIVVRGILQDGGVLPEAVIGVTVANTAHFLSVIVLFRLGQVVWRDRTL
SLVTALLHIVSPAGMFLTAPYMESSYAFLAFTGYLLFALSSQAESRALARDVYLVLAGIF
FGLATAFRSNGILNGIPFAWEVLRHLPNLPHKPFDTIRRLVALGIGGICVALGSIIPQAI
AYGQFCSGASGVDPRPWCEAYLPSIFTFVQEHYWNVGFLRYWTISNLPLFLLATPMLAIL
VRSGVEQPTSARQPVIAAKPVESAQLTSLVQSAAAAQVVLAVLAIAMYHVQIITRISSGY
PLWYWWVAGSLIRGEKVGGYIVKFMVLYALIQGVLFTSFLPPA

Enzyme Prediction     

No EC number prediction in XP_001906075.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	44	463	4.2e-122	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	5.95e-44	99	463	52	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	2.80e-16	104	463	71	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP28476.1|GT76	1.23e-317	1	463	1	463
CAP66741.1|GT76	1.23e-317	1	463	1	463
VBB80094.1|GT76	1.03e-312	1	463	1	461
AEO64180.1|GT76	7.22e-202	32	463	6	455
AEO58925.1|GT76	1.15e-184	38	463	19	458

PDB Hits     

XP_001906075.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2GSI6|GPI18_CHAGB	5.76e-176	29	463	8	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	3.40e-105	37	463	8	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	2.92e-91	33	463	12	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	5.43e-87	33	463	23	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	5.56e-55	40	463	4	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999981	0.000032

TMHMM  Annotations     

Start	End
43	65
145	167
180	202
232	254
280	302
343	365
386	408
412	431
438	460