CAZyme Information: XP_001905588.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001905588.1
• CAZy Family: CE1
• CAZyme Description: Exo-1,4-beta-D-glucosaminidase [Source:UniProtKB/TrEMBL;Acc:B2APB4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
929		104066.63	6.5117

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633876:90605-93548(-)

Full Sequence      

MRLQPLTVGVSAAANLHSVAADPLVFLNGQVTAIPSWDLQSSAEIGTDLAALSKTGVDTS
SWRHITTSKCTLMGCLINAGVYNEDDLFYSENMKRVDDRQFSVPWTYRQEYSLEPGPGKH
FFLKTHGITSRADIFLNGKQVASKDQQAGSFAGKNYDITKLVAKQNALAIQVHPTSYYHD
FALGWVDWNPWPADNGTGVWRDVEVKQTGPVALESLRIITKVGPTVERLKDPATVTLKSR
AENLEDKPMVVTAHGSVFAPFGRKAAPITWSKQLTLPPRSITDIVLETTVTDPAIWWPKQ
WGDQPLYSGALAITVNNTLSDSITQQFGFRSVTSKLNSHQDVTYIVNHVPFQVIGAGYTP
NIFLQFDPSRWEAELQYVLDLGLNTVRLEGKNEHPILYEIANRLGVFLMPGWECCDKWES
WSYNHDLFLNPPLVWSNADYTIANNSMLHEAAMLQTHPSVLTYLIGSDYWPDERATPIYL
NALKHYDWQTPIIGSASKRGYSPLTGPSGMKMEGPYDWVPPNYWYETSPPRAGSAFGFGS
ELGAGVGTPTVSSLTKFLSPSDLDDLWKNPTKPLYHMSREGSEFTTRQIYHSALSARWAS
PTSLEDYLMKSQIMDYEATRAQFEAFAVKWSDRNRPATGLIYWMLNNAWPSLHWNVWDYY
MKPGGSYYGAKAGARREHVVYDYITKEVWMVDRTADDFYREREVEIEVVGLDGGVKFGSL
VKVESLPNGSGRVAGLGGRGRWGQHTPPPQDSLPPAPAIQHFLPTPQINTHPRPFNQHPH
ALLPSIPFLQPSRLVHSKRNVYWLSKELDRLDWGETTWFVTPVGRYADYKEFNTLKEAEV
TVGVERRGEKEVVVNLENRASVPAFFVGLELLDGGGNDVLPLTWEDNFVTLWPGEKISLV
AKSVGSRGWQPASVRVGGKNVKEMLVSVS

Enzyme Prediction     

EC	3.2.1.165:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	59	679	1.6e-50	0.5877659574468085

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408168	Ig_GlcNase	4.66e-37	818	921	1	104	Exo-beta-D-glucosaminidase Ig-fold domain. This domain can be found in 2 glycoside hydrolase subfamily of beta-glucosaminidases (EC:3.2.1.165) such as CsxA, from Amycolatopsis orientalis that has exo-beta-D-glucosaminidase (exo-chitosanase) activity. It has an immunoglobulin-like topology.
225789	LacZ	3.01e-13	92	468	52	406	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
395572	Glyco_hydro_2	6.53e-08	211	330	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP65831.1|GH2	0.0	1	929	1	929
CDP30306.1|GH2	0.0	1	929	1	895
VBB82149.1|GH2	0.0	1	929	1	895
AEO67616.1|GH2	0.0	1	929	1	901
AEO60310.1|GH2	0.0	21	926	20	901

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VZS_A	8.13e-179	5	926	31	896	Chitosan Product complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZS_B Chitosan Product complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2X05_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X05_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis]
2VZO_A	3.18e-178	5	926	31	896	Crystal structure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZO_B Crystal structure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis]
2VZT_A	6.29e-178	5	926	31	896	Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZT_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZV_A Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis],2VZV_B Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis]
2VZU_A	1.90e-176	5	926	31	896	Complex of Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZU_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis]
5N6U_A	6.97e-24	57	706	38	687	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C0LRA7|EBDG_HYPVI	0.0	14	928	13	890	Exo-beta-D-glucosaminidase OS=Hypocrea virens OX=29875 GN=gls1 PE=2 SV=1
sp|Q4R1C4|EBDG_HYPJE	0.0	9	928	14	892	Exo-beta-D-glucosaminidase OS=Hypocrea jecorina OX=51453 GN=gls93 PE=1 SV=1
sp|D4AUH1|EBDG_ARTBC	3.61e-274	6	926	15	882	Exo-beta-D-glucosaminidase ARB_07888 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07888 PE=1 SV=1
sp|Q82NR8|EBDG_STRAW	2.33e-186	3	926	21	901	Exo-beta-D-glucosaminidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=csxA PE=1 SV=1
sp|Q56F26|EBDG_AMYOR	1.64e-177	5	926	31	896	Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis OX=31958 GN=csxA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.918728	0.081297

TMHMM  Annotations     

There is no transmembrane helices in XP_001905588.1.