CAZyme Information: XP_001905569.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001905569.1
• CAZy Family: CE1
• CAZyme Description: Beta-xylanase [Source:UniProtKB/TrEMBL;Acc:B2APG8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		42217.18	9.5268

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633876:20732-22049(+)

Full Sequence      

MRFLPSVALALGGFVTANPVPVDHEAVEYVPVSLPLTCRENLTSAATGSSTVNEFGSITP
ENAQKWDATEPNRGQFNWGAADQHMNWARQNGKHVRCHTLVWYSQLPGWVSNSRFNNATL
IQVMTNHINQVMGRYRGQCNHWDVDGTYRDNVFLRTIGEAYIPMAFRIAAAADPSAKLYY
NDYNLEYLGPKVEGAARIVRLCYNLEYLGPKVEGAARIVRLCQQYGVRIDGVGYQGHLVT
ESTPTQSTPTPSEADLTAALKITADLGVDVAYTEIDIRMRTPSNAQKLQALADAYGRVAR
SCMNVPRCVGMTIWVRPLDMTSLVLQLLTVRNRASVTGTRGFPRLSRVKVTRFFGTTTIK
RRRRTTLSCGVFLGSKFDLG

Enzyme Prediction     

EC	3.2.1.8:2	3.2.1.4:1	3.2.1.8:2	3.2.1.4:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	47	314	9.5e-70	0.7920792079207921

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	1.22e-102	54	314	34	273	Glycosyl hydrolase family 10.
214750	Glyco_10	4.59e-89	65	314	2	232	Glycosyl hydrolase family 10.
226217	XynA	9.23e-62	10	314	34	300	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP65811.1|GH10	1.17e-265	1	380	1	380
CDP30325.1|GH10	2.14e-226	1	380	1	330
VBB82168.1|GH10	2.34e-188	1	314	1	315
AGG68960.1|GH10|3.2.1.8	8.71e-146	1	314	1	314
AUS45830.1|GH10	1.05e-123	6	314	8	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3U7B_A	2.03e-115	53	314	37	285	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]
6JDT_A	1.13e-80	50	314	34	278	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	1.56e-72	54	314	60	300	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
1V6Y_A	9.73e-65	54	314	37	275	Crystal Structure Of chimeric Xylanase between Streptomyces Olivaceoviridis E-86 FXYN and Cellulomonas fimi Cex [Streptomyces olivaceoviridis]
3WUF_A	4.36e-63	53	314	36	273	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B3A0S5|XYNA_FUSO4	1.05e-114	53	314	37	285	Endo-1,4-beta-xylanase A OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) OX=426428 GN=FOXG_17421 PE=1 SV=1
sp|I1RQU5|XYN1_GIBZE	1.68e-112	50	314	50	301	Endo-1,4-beta-xylanase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYL1 PE=1 SV=1
sp|Q2PGV8|XYN2_AURPU	4.58e-87	54	314	67	316	Endo-1,4-beta-xylanase 2 OS=Aureobasidium pullulans OX=5580 GN=xynII PE=1 SV=1
sp|P79046|XYN1_HUMGT	6.67e-80	50	314	53	298	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1
sp|Q5ZNB1|XYND_TALFU	5.04e-70	54	314	55	295	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000260	0.999716	CS pos: 17-18. Pr: 0.9769

TMHMM  Annotations     

There is no transmembrane helices in XP_001905569.1.