CAZyme Information: XP_001905375.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001905375.1
• CAZy Family: CBM50
• CAZyme Description: Podospora anserina S mat+ genomic DNA chromosome 5, supercontig 5 [Source:UniProtKB/TrEMBL;Acc:B2AMU4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644		69253.61	6.1841

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633871:234686-236745(+)

Full Sequence      

MWFLRNDVVAAVLLLAPFSLAAPTEYSKKLPQFATIINRRQLNANNATYDFIIAGGGIAG
LTLADRLTEDPNVKVLVIEAGPIDPGLEGIQVPGSFSPWYYFWPNLLTVPQTALNNRVIG
TVSGQVLGGGSAINAMVYVRGDADDYDAWGFMQRRGNSSFYGNSSVSSSMSWNTMLPYFL
KSENFTAPDAAYALEANITWNPAVRGTSGPLKYTYPPYYFPGAANWWNAAQSVGLPPVDD
PLSGIKNGIFPIPSVLDADTMTRNYAKINHHDRVKQARPNYHVLAGNIVGKVLFDPSCKK
AIGVEYLPTSGGAATNVFASKEVILAAGGINTPKILQLSGIGPKKLLDKFGIKVVSNLPG
VGQNLQDQPTLTVPYTFTNNLTPNSGSLMANATYNAEQRALYDTERKGAYTIISSLSTNI
GQLSLKQATSDYQAIIAAARAANPADSLPADVDATVLAGYRVQREAILNQFEGDVGVGNL
HWGTSDNALVYHLKPLSRGTVEIVTTDPLVNPAIDHRTATDPIDFAVYTALFRKNRELFA
APDMQVLGPAEGAPFAAATTNEEIIEVMRDQINPSNAHQCCTAAMLPKSLGGVVNSEQKV
YGVSRLRVADISFWPMQTAGSPLGTMYAAGERLADMIKAEYGLA

Enzyme Prediction     

No EC number prediction in XP_001905375.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	48	639	1.7e-166	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.60e-82	48	638	5	532	choline dehydrogenase; Validated
225186	BetA	2.53e-81	46	644	5	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	7.35e-30	495	633	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	8.71e-27	112	370	12	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.20e-20	8	637	7	576	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP29496.1|AA3_2	0.0	1	644	1	644
CAP65285.1|AA3_2	0.0	1	644	1	644
VBB81292.1|AA3_2	0.0	1	644	1	644
AEO67797.1|AA3_2	3.83e-297	1	644	1	639
BCS25132.1|AA3_2	6.96e-206	30	642	21	618

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	2.86e-281	46	644	3	589	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	7.18e-93	39	641	26	642	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4YNT_A	1.13e-65	45	638	2	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	1.59e-60	45	639	13	589	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5NIT_A	2.28e-51	43	641	12	577	Glucose oxidase mutant A2 [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	4.04e-200	34	642	25	618	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	7.48e-77	45	638	36	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.54e-68	48	637	46	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.54e-68	48	637	46	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	4.19e-58	11	640	10	610	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001459	0.998501	CS pos: 21-22. Pr: 0.9684

TMHMM  Annotations     

There is no transmembrane helices in XP_001905375.1.