CAZyme Information: XP_001904207.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001904207.1
• CAZy Family: AA7
• CAZyme Description: Podospora anserina S mat+ genomic DNA chromosome 5, supercontig 1 [Source:UniProtKB/TrEMBL;Acc:B2AEW8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613		64992.27	5.7410

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633457:618019-619915(+)

Full Sequence      

MDSEHDFIIVGGGTSGLVVAARLTEDPNTSVLVVEAGTEHTNDPRIRTPAFWLSVLGSPD
FDWAYKTVPQKGLDGKVIPLSQGKLIGGSSAINGLAFVANSKAAVDAWGAFGNPGWDWET
LGPYYKKFHTLAHPSDTAGKHLRLSYVDESVRGCDGPIKASFPEESKDPLPNAWVDTIGA
LGFPASGDPFSGKFSGGYVNALSVDPESRTRSDAATAYFEPAKSRPNLHVVTSALAEKIL
FDTAGASPKAVGVQIQKDGKTVTLAAKKEVILAAGVFGSPKLLELSGVGNRELLEKLNIP
VVVDNPNVGENLQDHPVSSVSFEVEEGVKTIDALTRQDPEAVGAAMQEYMTNKSGPFAVG
NFTGSLLPVADFVGPDGKSTLDQVIKQITASNPSPSSGDFTPHHTEFVHSVLANRAEGAG
NLFMYAACANVNPDSVGADIIVKDASPANFVTICAALCYPLSRGSAHITSSNAADLSVID
PRYLEHPLDLEVQARLLRYAETIVRTEPLSKFIKRGGRRNAGAPADLSDLDVAKQYSKLS
ALSCWHPTSTCAMLPRERGGVVDARLHVHGVEGLRIVDSSIIPLATRGNTQTTVYAVAER
AADLIKKEYGIGN

Enzyme Prediction     

No EC number prediction in XP_001904207.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	607	3.8e-182	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	7.06e-104	1	606	2	532	choline dehydrogenase; Validated
225186	BetA	1.11e-98	1	608	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	6.39e-35	460	601	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.16e-33	74	317	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.22e-27	2	594	53	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP29061.1|AA3_2	0.0	1	613	1	613
VBB80802.1|AA3_2	0.0	1	613	1	613
QKX53653.1|AA3_2	2.32e-222	4	608	6	610
ANH22750.1|AA3_2	1.07e-211	3	606	42	642
UPM17946.1|AA3_2	1.04e-183	4	611	7	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	3.50e-88	3	608	4	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.98e-85	3	609	4	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	2.31e-73	4	608	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.44e-72	3	608	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	1.12e-67	4	609	40	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	2.42e-101	1	609	10	620	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A142PTM2|CITC_MONPU	1.59e-98	1	612	10	615	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	1.59e-98	1	612	10	615	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	3.68e-96	6	608	41	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.14e-79	4	605	46	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000005

TMHMM  Annotations     

There is no transmembrane helices in XP_001904207.1.