CAZyme Information: XP_001904120.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001904120.1
• CAZy Family: AA4
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:B2AEN1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	CU633457|CGC3	39713.72	5.2234

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633457:350330-351394(-)

Full Sequence      

MGGVPTRPATRIMIVGDSISHGREGDWTWRYRIWEWFRQNNTPVVFVGPHKGTIPPPPED
DRTRDGGYAPDVDRDFLQDCYHYSWWGKAACVVKDGIGEQVATHKPDLCLVELGFNDIGW
GISDPGGTLKSMEALITEARTHNQALKFAIANVPQRTIVPGLGDLPVRVETYNELLAQAI
PSWNQPSSPVVLVHLCENYLCREGSYDGLHPGALGEFEIAQAFSRTLLSPEFALTDRSTK
ELEIPQPVPRRVLSTPVNLAAAASSPNREGWVRLTVTWDLVYGAYSYDIRIKTGHDDAWW
DWHPVQDTRYQLWCSPMYLPTPEWKAQVRATAGEHVTSNNSQLVNVIVGKEDDL

Enzyme Prediction     

No EC number prediction in XP_001904120.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	11	227	3.2e-42	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.40e-35	11	227	2	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	4.82e-08	12	223	1	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	7.41e-07	99	215	55	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238866	sialate_O-acetylesterase_like2	1.13e-05	97	215	41	156	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225353	TesA	1.27e-04	99	222	70	203	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ09962.1|CE0	2.53e-77	11	351	513	858
SCG40251.1|CE0	1.15e-74	9	334	335	662
CAK39824.1|CE0	1.63e-70	11	228	140	368
BAE63679.1|CE0	1.38e-68	8	228	55	292
BAE60780.1|CE0	1.25e-49	66	279	38	243

PDB Hits     

XP_001904120.1 has no PDB hit.

Swiss-Prot Hits     

XP_001904120.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000001

TMHMM  Annotations     

There is no transmembrane helices in XP_001904120.1.