CAZyme Information: XP_001903875.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001903875.1
• CAZy Family: AA3
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:B2ADY6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
792		84487.71	5.0247

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633455:70043-72780(+)

Full Sequence      

MKLLSRVGATALAASLYLQHGIAQMADGTYTDQTSGIKFKTWTQGTEATEASPFTFGLAL
PGDALTKNANEYLGILVRCKIEDAAAPGWCGLSHGQAGQMTNALLLVAWASEGTVYTSFR
WATGYTLPGLYTGDAKLTQVSSNVTDTHFELIYRCQNCFSWNQDGTSGSVETTQGFLVLG
HAAGSSGLENPTCPDRATFGFHDAGFGQWGAPLEGATSESYAEWAQLATTTPETDCEGTG
PGDAECTPAPEKVYDYIVVGGGAGGIPVADKLSAAGHSVLLIEKGPPSSGRWGGTMKPKW
LEGTNLTRFDVPGLCNQIWVDSAGIACTDTDQMAGCVLGGGTAVNAGLWWKPPASDWDYN
FPAGWKSKDVEAAANRVFDRIPGTFKPSADGVLYRREGFDVLSSGLRKSGYKEVVANQSP
NEKNGAFAHTHFMFRYGERDGPLATYLVSANNRDNFDLWTGSAVRRAIRTGGKVTGVELE
CLRDGGYSGEVKISAKGGVIFSAGTFGSAKLLMRSGIGPRDQLEIVAGSKDGETFISRDQ
WIDLPVGSNLIDHLNTDLILTHPDVVFYDFYEAWTAPNEGDKERYLNNRTGILTQAAPNI
GPMVWEEVTPSDGIPRQFQWTARVEGDGRITDSPHAMTLSQYLGRGVVSRGRMTITPGLA
TAVSEHPYLHNAGDKEAVIAGIKKLQAALNVIPNITWVLPPPTGTVEDYVNGLPVSPSAR
RSNHWMGTAKLGTDDGREGGTAVVDLDTKVYGTDNLFVVDASIFPGMSTGNPSGMIVIAA
EKAAERILALKA

Enzyme Prediction     

EC	1.1.99.18:13	1.1.99.18:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	246	790	5.7e-245	0.9817518248175182
AA8	30	224	8.3e-63	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	2.21e-71	30	220	1	177	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
225186	BetA	3.65e-43	271	792	25	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
187688	CDH_like_cytochrome	1.15e-41	29	213	1	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
235000	PRK02106	3.05e-25	446	788	206	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.76e-24	649	783	3	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP61651.1|AA3_1|AA8	0.0	1	792	1	792
CDP28002.1|AA3_1|AA8	0.0	1	792	1	792
VBB79670.1|AA3_1|AA8	0.0	1	792	1	791
AEO59298.1|AA3_1|AA8|1.1.99.18	0.0	1	791	1	786
AEO64604.1|AA3_1|AA8	0.0	1	791	1	787

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI6_A	0.0	29	790	7	767	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI7_A	4.44e-313	26	789	3	765	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI4_A	6.49e-254	248	790	1	545	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1NAA_A	3.27e-117	254	790	3	537	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	3.80e-117	254	790	8	542	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	4.90e-146	30	790	24	769	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|P64264|Y1310_MYCBO	6.67e-23	255	787	6	526	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1
sp|P9WMV4|Y1279_MYCTO	6.67e-23	255	787	6	526	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	6.67e-23	255	787	6	526	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1
sp|Q8D3K2|BETA_VIBVU	3.25e-21	251	788	2	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000434	0.999536	CS pos: 23-24. Pr: 0.9768

TMHMM  Annotations     

There is no transmembrane helices in XP_001903875.1.