CAZyme Information: XP_001903789.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001903789.1
• CAZy Family: AA3
• CAZyme Description: Cellulase [Source:UniProtKB/TrEMBL;Acc:B2ADQ0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302	CU633454|CGC3	31218.55	7.2133

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633454:622982-623943(+)

Full Sequence      

MRSSTVLQTSLLAVLPLAVQAQGASGSGKSTRYWDCCKPSCAWPGKAAVNRPVFACDANF
QRISDSGVASGCNGGSAYSCADHSAWAINDNLSYGFAATALSGGSEASWCCACYELTFTD
GPVAGKKMVVQSTSTGGDLGSNHFDLNIPGGGVGLFDGCKPQFGGLPGATYGGISDRSQC
ASFPDALKPGCNWRFDWFKNADNPSFTFRQVQCPSELTARSGCKRDDDSRFPVFSPPGGG
SQPQPQPTSSAAQNPNPTPSAAPGGCRAAKYAQCGGQGFTGCTTCEAGSTCTASNQWYSQ
CL

Enzyme Prediction     

No EC number prediction in XP_001903789.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	28	224	2e-84	0.9949494949494949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	3.69e-79	27	224	1	214	Glycosyl hydrolase family 45.
395595	CBM_1	1.23e-10	270	298	1	29	Fungal cellulose binding domain.
197593	fCBD	5.04e-09	269	302	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP61565.1|CBM1|GH45	3.80e-218	1	302	1	302
CDP27919.1|CBM1|GH45	3.80e-218	1	302	1	302
VBB79574.1|CBM1|GH45	2.56e-216	1	302	1	302
EAA27871.1|CBM1|GH45|3.2.1.4	1.07e-160	1	301	1	292
CAD70529.1|CBM1|GH45|3.2.1.4	1.07e-160	1	301	1	292

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MVI_A	3.69e-162	1	301	1	292	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5GLX_A	3.02e-136	21	236	1	216	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
5GLY_A	7.49e-136	24	236	1	213	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
1OA7_A	4.71e-130	27	237	2	212	Structure of Melanocarpus albomyces endoglucanase in complex with cellobiose [Melanocarpus albomyces],1OA9_A Structure of Melanocarpus albomyces endoglucanase [Melanocarpus albomyces]
1L8F_A	3.49e-128	27	231	2	206	Structure of 20K-endoglucanase from Melanocarpus albomyces at 1.8 A [Melanocarpus albomyces]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43316|GUN5_HUMIN	2.45e-124	28	237	3	213	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|P45699|GUNK_FUSOX	1.45e-113	16	243	12	239	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|D3GDK4|GUN_CRYAT	9.11e-84	25	225	19	221	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|O97401|GUN_PHACE	2.79e-60	23	223	35	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P18126|GUNB_CELJU	4.53e-44	27	225	268	500	Endoglucanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999780	CS pos: 21-22. Pr: 0.9809

TMHMM  Annotations     

There is no transmembrane helices in XP_001903789.1.