CAZyme Information: XP_001903765.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001903765.1
• CAZy Family: AA3
• CAZyme Description: Pectate lyase [Source:UniProtKB/TrEMBL;Acc:B2ADM5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	CU633454|CGC1	25011.20	7.9705

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633454:561993-562863(+)

Full Sequence      

MFSNAGQIALTLLAAAPTALACLGYTGGLPKATGNVVLTLTAPIYVKAGQVYDGGWRKFD
RNPSSCNGQSEGGEKDTAFVVERGGTLRNVIIGKTVGEGVYCKGGGCNLEFIWFEDVCED
AISIKDDRPGDVTNIIGGGAYHASDKVIQHNGCGRVNVSVLRSTPHGTSNSNILGRSSTS
MPRTTKCAREVYVEGVTARKGGEVVGITKANGDKATLVNVCTDAKTPCQNYSGPGAKDGA
C

Enzyme Prediction     

EC	4.2.2.2:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	39	233	8.6e-71	0.9690721649484536

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	4.17e-76	26	234	1	196	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP61540.1|PL3_2	9.49e-177	1	241	1	241
CDP27896.1|PL3_2	8.13e-173	1	241	1	239
VBB79534.1|PL3_2	7.73e-151	1	241	1	231
UPK92652.1|PL3_2	7.11e-121	7	241	4	228
UQC76789.1|PL3_2	3.38e-115	1	241	1	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	1.31e-17	44	167	9	128	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	9.01e-15	33	151	4	115	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	9.18e-15	33	151	5	116	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	7.43e-14	33	151	13	124	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z06_A	7.43e-14	33	151	13	124	C. bescii Family 3 pectate lyase double mutant K108A/R133A in complex with ALPHA-D-GALACTOPYRANURONIC ACID [Caldicellulosiruptor bescii DSM 6725],4Z06_B C. bescii Family 3 pectate lyase double mutant K108A/R133A in complex with ALPHA-D-GALACTOPYRANURONIC ACID [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CCF8|PLYF_ASPTN	2.43e-75	1	233	1	219	Probable pectate lyase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyF PE=3 SV=1
sp|B8NJZ7|PLYF_ASPFN	3.45e-75	1	233	1	219	Probable pectate lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyF PE=3 SV=2
sp|A1D5E3|PLYF_NEOFI	2.60e-72	17	233	13	219	Probable pectate lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyF PE=3 SV=1
sp|Q4WKV8|PLYF_ASPFU	2.60e-72	17	233	13	219	Probable pectate lyase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyF PE=3 SV=1
sp|B0Y953|PLYF_ASPFC	3.69e-72	17	233	13	219	Probable pectate lyase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000610	0.999350	CS pos: 21-22. Pr: 0.9657

TMHMM  Annotations     

There is no transmembrane helices in XP_001903765.1.