CAZyme Information: XP_001903739.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001903739.1
• CAZy Family: AA3
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:B2ADJ9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294	CU633454|CGC1	32099.59	7.0939

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633454:482552-483543(+)

Full Sequence      

MKTCAGEPSTQIDRSLRLHQATQDSGHEFWEGDKKADLLALLAPIHYDHVLKQAPQSFKM
QLSNLLTIALAGLAAASPVELVERQQKLRIMPLGDSITEIACWRAFVWDQIAAAGFANQV
QYVGSQNSNPQGCRPTTTNWDQRHEGHSGWLAIDIANNYLANWLRSTPADIVQFMLGTND
VFRGRSTNDIIAAYTKMVQIMRAANPKMKIIVDLVIPLGVGSNSGIQALNARIPAWAAGL
NTTESPIVIADCNTGYKTSDLRDGVHPSIAGDQFLATKIGPPLLNYIRESLAGN

Enzyme Prediction     

No EC number prediction in XP_001903739.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	88	277	1.9e-52	0.9639175257731959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.67e-43	88	283	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	3.32e-15	93	271	2	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	3.28e-11	93	281	4	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	7.18e-10	166	237	46	120	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238872	SGNH_hydrolase_like_2	5.88e-08	89	276	3	185	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP27869.1|CE3	9.69e-217	1	294	1	294
CAP61514.1|CE3	9.69e-217	1	294	1	294
VBB79507.1|CE3	9.30e-215	1	294	1	294
AEO64701.1|CE3	4.72e-132	63	292	5	235
AEO59370.1|CE3	8.53e-121	62	291	4	233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	9.63e-65	88	289	2	205	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	2.73e-64	88	289	2	205	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]

Swiss-Prot Hits     

XP_001903739.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999634	0.000384

TMHMM  Annotations     

There is no transmembrane helices in XP_001903739.1.