CAZyme Information: XP_001903645.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001903645.1
• CAZy Family: AA3
• CAZyme Description: Probable exoglucanase GH6D [Source:UniProtKB/Swiss-Prot;Acc:B2ADA5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	CU633454|CGC2	45611.69	7.7348

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633454:162077-163437(+)

Full Sequence      

MRAVYAILAGLLATGSASPLEARQSGNPFVGRSLFVNPKYSESLERTRQAFLSRGDQTNA
AKVQYVQNKVGTFVWISNIFLLRDIDDAIRNARAAQSRGEKPIVGLVLYNLPDRDCSAGH
SSGELSLDQNGLNRYRTEYVQPFAQKLKAASDLQFAVILEPDAIGNMVTGTTAFCRNARG
PQQDGIAYAIQQLQASNIHLYLDVANGGWLGWADNLKPTTILQKAGSNARIRGYSSNVSN
YNPYSTNNPPPYTAGSPSADESRYATSLGNALRERGLPTNFIIDQGRVALDGARKEWGEW
CNVSPAGFGQPFTTNTNNPNVDAILWVKPGGESDGTCGMSGAPQAGAWFDAYAQMLTTNA
HPEIRADGGGGGSPAPGPSSTAVAPSPSATPGGNCAARWAQCGGQGWTGPTCCAQGTCQA
SNQWYSQCL

Enzyme Prediction     

EC	3.2.1.91:55	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	47	338	1.7e-76	0.9591836734693877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	2.44e-137	56	343	1	293	Glycosyl hydrolases family 6.
227616	CelA1	6.31e-45	6	360	4	410	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].
197593	fCBD	1.38e-13	397	429	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	2.28e-12	398	425	1	29	Fungal cellulose binding domain.
368691	Toxin_7	0.005	395	429	2	34	Toxin 7. This family consists of several short spider neurotoxin proteins including many from the Funnel-web spider.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP27774.1|CBM1|GH6	3.38e-308	1	429	1	429
CAP61420.1|CBM1|GH6	3.38e-308	1	429	1	429
VBB79393.1|CBM1|GH6	6.49e-305	1	429	1	434
CAD71092.1|GH6	5.76e-138	1	365	1	381
AEO57190.1|GH6	1.53e-137	4	364	7	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DYS_A	1.49e-207	24	364	1	346	Endoglucanase CEL6B from Humicola insolens [Humicola insolens],1DYS_B Endoglucanase CEL6B from Humicola insolens [Humicola insolens]
3A64_A	4.29e-93	17	364	3	379	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3A9B_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3ABX_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOF_A	6.80e-92	17	364	3	379	Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOG_A	1.09e-84	25	366	6	364	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOH_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOI_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOJ_A	1.71e-83	25	366	6	364	Chain A, Cellobiohydrolase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2ADA5|GH6D_PODAN	6.01e-309	1	429	1	429	Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=GH6D PE=3 SV=1
sp|Q7SIG5|GUN6_HUMIN	7.66e-207	24	364	1	346	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|B2AC20|CEL6B_PODAN	4.10e-129	7	364	34	411	1,4-beta-D-glucan cellobiohydrolase CEL6B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6B PE=1 SV=1
sp|P49075|GUX3_AGABI	6.71e-84	25	364	88	438	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|Q4WFK4|CBHC_ASPFU	2.06e-76	25	362	96	452	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000338	0.999631	CS pos: 23-24. Pr: 0.7267

TMHMM  Annotations     

There is no transmembrane helices in XP_001903645.1.