CAZyme Information: XP_001903343.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001903343.1
• CAZy Family: AA11
• CAZyme Description: Podospora anserina S mat+ genomic DNA chromosome 3, supercontig 1 [Source:UniProtKB/TrEMBL;Acc:B2ACF0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299	CU633448|CGC1	32178.16	8.6641

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633448:272269-273422(-)

Full Sequence      

MKLFSQMTAALTAGFALFGADSVMAQSLTRVNNFGSNPSNAKMFIYVPRNLAAKPPIIVA
IHYCTGTAQAYFSGSPYRQLADQKGFIVIYPESPYSGTCWDVSSRATLTHDGGGNSNAIA
NMVKYTLQQYNGDPTKVFVTGTSSGGMMTNVMAATYPDLFAAGIVYSGTAAGCFYSQSGG
TNAWNSSCAQGQVRSTPQVWAKMVFDAYPGYEGPRPKMQIYHGSADTTLHANNYNETIKQ
WAGVFGLDPAKPDVTQANTPQSRYTTYSWDNGKLIGVYAQGVGHSVNMRGADDMKFFGL

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	40	241	1.2e-24	0.8105726872246696

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	1.70e-40	43	248	1	201	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	9.76e-28	1	284	5	274	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	3.14e-26	45	250	5	204	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
224423	DAP2	2.77e-09	40	169	379	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
395257	Peptidase_S9	2.07e-07	79	168	8	97	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP26566.1|CE1	2.92e-225	1	299	1	299
CAP61115.1|CE1	2.92e-225	1	299	1	299
VBB76664.1|CE1	5.88e-225	1	299	1	299
AEO67255.1|CE1	3.92e-167	27	299	13	284
AEO58247.1|CE1	7.49e-165	1	299	1	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.13e-125	27	299	3	274	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBP9|AXE1_NEOFI	1.66e-134	23	299	29	304	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1
sp|Q4WBW4|AXE1_ASPFU	1.05e-133	20	299	26	304	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1
sp|B8NBI2|AXE1_ASPFN	1.48e-130	25	299	32	305	Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=axeA PE=3 SV=1
sp|A9JPE6|AXE1_ASPFL	1.21e-129	25	299	32	305	Probable acetylxylan esterase A OS=Aspergillus flavus OX=5059 GN=axeA PE=3 SV=1
sp|Q75P26|AXE1_ASPOR	1.21e-129	25	299	32	305	Acetylxylan esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=axeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000364	0.999589	CS pos: 25-26. Pr: 0.9728

TMHMM  Annotations     

There is no transmembrane helices in XP_001903343.1.