CAZyme Information: XP_001903209.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001903209.1
• CAZy Family: AA1
• CAZyme Description: 1,4-beta-D-glucan cellobiohydrolase CEL6B [Source:UniProtKB/Swiss-Prot;Acc:B2AC20]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419	CU633447|CGC2	45947.68	6.4311

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633447:91530-92848(-)

Full Sequence      

MGESFLLLQPASPALSPTPSSLLLGPTITMRADVLIAALATGALVAAVPTSPKKPTPPKG
DVSNPFVGKTQFVNPEWSNKLTQTYKSFLKKGDVKNAFRTLQAQKVSTFVWVSRLSELSR
IDEAIATARRVQKTTGKKQIVGLVLYNLPDRDCSAGESAGELLSGENGFERYKEEFVKPY
AQKVAAAKDLEFAIVLEPDSLGNLVTNLNIPLCAGAVDTYRDGIAHAITQLQQDHVHLYI
DAAHGGWLGWNDNLPLAADEFAEVLKRADEASGKKNKIRGFATNVSNYNPLHAVVRENYT
EWSNSWDESHYASSLAPHLEERGLPAHFIVDQGRVANPGARKEWGEWCNVAPSGFGPAPS
TNTNNTVVDAIVWIKPGGESDGECGYFNAPRAGHWHDEFAQQLVQNAHPSVYENWWKFW

Enzyme Prediction     

EC	3.2.1.91:55	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	84	385	7.7e-82	0.9591836734693877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	1.09e-146	93	391	1	293	Glycosyl hydrolases family 6.
227616	CelA1	9.32e-43	62	411	22	443	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP26446.1|GH6|3.2.1.4	4.09e-317	1	419	1	419
CAP60981.1|GH6|3.2.1.4	4.09e-317	1	419	1	419
VBB76538.1|GH6	3.60e-311	6	419	115	528
AGV05123.1|GH6	8.17e-207	30	416	1	380
AKI05479.1|GH6	1.68e-204	30	415	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DYS_A	2.22e-127	64	411	4	346	Endoglucanase CEL6B from Humicola insolens [Humicola insolens],1DYS_B Endoglucanase CEL6B from Humicola insolens [Humicola insolens]
3A64_A	2.82e-108	64	411	14	379	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3A9B_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3ABX_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOF_A	4.53e-107	64	411	14	379	Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOG_A	7.99e-91	58	411	2	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOH_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOI_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOJ_A	1.27e-89	58	411	2	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2AC20|CEL6B_PODAN	7.27e-318	1	419	1	419	1,4-beta-D-glucan cellobiohydrolase CEL6B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6B PE=1 SV=1
sp|B2ADA5|GH6D_PODAN	4.96e-130	64	411	27	364	Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=GH6D PE=3 SV=1
sp|Q7SIG5|GUN6_HUMIN	1.14e-126	64	411	4	346	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|P49075|GUX3_AGABI	9.02e-88	64	411	90	438	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|A2QYR9|CBHC_ASPNC	3.67e-79	49	410	85	458	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.871287	0.128716

TMHMM  Annotations     

There is no transmembrane helices in XP_001903209.1.