CAZyme Information: XP_001903170.1

Basic Information

• Species: Podospora anserina
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora anserina
• CAZyme ID: XP_001903170.1
• CAZy Family: AA1
• CAZyme Description: 1,4-beta-D-glucan cellobiohydrolase CEL6A [Source:UniProtKB/Swiss-Prot;Acc:B2ABX7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484		51053.97	6.4812

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PanserinaSmat	10888	515849	370	10518

• Gene Location: location=CU633446:188410-189953(-)

Full Sequence      

MAKRLLLTAALAATTLAAPVIEERQNCGSVWSQCGGQGWTGATCCASGSTCVAQNQWYSQ
CLPGSQVTTTAQAPSSTRTTTSSSSRPTSSSISTSAVNVPTTTTSAGASVTVPPGGGASS
TASYSGNPFLGVQQWANSYYSSEVHTLAIPSLTGPMATKAAAVAKVPSFQWMDRNVTVDT
LFSGTLADIRAANRAGANPPYAGIFVVYDLPDRDCAAAASNGEWAIADGGAAKYKAYIDR
IRHHLVQYSDIRTILVIEPDSLANMVTNMNVPKCQGAANTYKELTVYALKQLNLPNVAMY
LDAGHAGWLGWPANIGPAAELFAGIYKDAGRPTSLRGLATNVANYNGWSLSSAPSYTTPN
PNFDEKRFVQAFSPLLTAAGFPAHFITDTGRSGKQPTGQLEWGHWCNAIGTGFGPRPTTD
TGLDIEDAFVWIKPGGECDGTSDTTAARYDHHCGFADALKPAPEAGQWFQAYFEQLLTNA
NPPF

Enzyme Prediction     

EC	3.2.1.91:55	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	153	445	1.4e-89	0.9319727891156463

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	7.02e-154	167	448	15	293	Glycosyl hydrolases family 6.
227616	CelA1	4.36e-41	109	482	2	441	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].
197593	fCBD	1.50e-14	30	62	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	4.27e-14	31	58	2	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP60942.1|CBM1|GH6|3.2.1.91	0.0	1	484	1	484
CDP24957.1|CBM1|GH6|3.2.1.91	0.0	1	484	1	484
VBB75002.1|CBM1|GH6	0.0	1	484	1	484
AGV05128.1|CBM1|GH6	1.45e-265	1	484	1	482
ABT06036.1|CBM1|GH6|3.2.1.91	1.79e-254	1	484	1	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4A05_A	6.32e-227	121	484	1	364	Chain A, Cellobiohydrolase Family 6 [Thermochaetoides thermophila]
1OCB_A	1.01e-213	124	484	1	362	Structure of the wild-type cellobiohydrolase Cel6A from Humicolas insolens in complex with a fluorescent substrate [Humicola insolens],1OCB_B Structure of the wild-type cellobiohydrolase Cel6A from Humicolas insolens in complex with a fluorescent substrate [Humicola insolens],2BVW_A CELLOBIOHYDROLASE II (CEL6A) FROM HUMICOLA INSOLENS IN COMPLEX WITH GLUCOSE AND CELLOTETRAOSE [Humicola insolens],2BVW_B CELLOBIOHYDROLASE II (CEL6A) FROM HUMICOLA INSOLENS IN COMPLEX WITH GLUCOSE AND CELLOTETRAOSE [Humicola insolens]
1OC5_A	2.18e-213	122	484	1	364	D405N mutant of the CELLOBIOHYDROLASE CEL6A FROM HUMICOLA INSOLENS in complex with methyl-cellobiosyl-4-deoxy-4-thio-beta-D-cellobioside [Humicola insolens],1OC6_A structure native of the D405N mutant of the CELLOBIOHYDROLASE CEL6A FROM HUMICOLA INSOLENS at 1.5 angstrom resolution [Humicola insolens],1OC7_A D405N mutant of the CELLOBIOHYDROLASE CEL6A FROM HUMICOLA INSOLENS in complex with methyl-tetrathio-alpha-d-cellopentoside at 1.1 angstrom resolution [Humicola insolens]
1BVW_A	1.54e-212	126	484	1	360	Cellobiohydrolase Ii (Cel6a) From Humicola Insolens [Humicola insolens]
1OCJ_A	1.66e-212	124	484	1	362	Mutant D416A of the CELLOBIOHYDROLASE CEL6A FROM HUMICOLA INSOLENS in complex with a THIOPENTASACCHARIDE at 1.3 angstrom resolution [Humicola insolens],1OCN_A Mutant D416A of the CELLOBIOHYDROLASE CEL6A FROM HUMICOLA INSOLENS in complex with a cellobio-derived isofagomine at 1.3 angstrom resolution [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2ABX7|CEL6A_PODAN	0.0	1	484	1	484	1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6A PE=1 SV=1
sp|Q9C1S9|GUX6_HUMIN	2.15e-247	7	484	6	476	Exoglucanase-6A OS=Humicola insolens OX=34413 GN=cel6A PE=1 SV=1
sp|G4MM92|CEL6A_MAGO7	4.95e-218	1	483	1	486	1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=cel6A PE=1 SV=1
sp|A1CCN4|CBHC_ASPCL	5.52e-202	13	484	9	464	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=cbhC PE=3 SV=1
sp|P07987|GUX2_HYPJE	4.06e-201	5	484	5	470	Exoglucanase 2 OS=Hypocrea jecorina OX=51453 GN=cbh2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000311	0.999693	CS pos: 24-25. Pr: 0.9456

TMHMM  Annotations     

There is no transmembrane helices in XP_001903170.1.