CAZyme Information: VDB92625.1

Basic Information

• Species: Blumeria graminis
• Lineage: Ascomycota; Leotiomycetes; ; Erysiphaceae; Blumeria; Blumeria graminis
• CAZyme ID: VDB92625.1
• CAZy Family: GT62
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513		58871.16	6.3014

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgraminisTritici96224	8470	1268274	123	8347

• Gene Location: location=LR026992:1504923-1506464(-)

Full Sequence      

MVPKRYMMMSILLLVVWIAFYTRLGRNGDDHMHKVNSWITTGTKLEAYSPCTENIAWLEP
YKFSYPIRYVSRNITAVQTPNKSRSSITVMDKPLFAGFTTVDLKQSSEVSNNECLPSLTI
EVSRTKVPPVDASNIIFGLQTTIARLRDTVKHLARWLPHTGARLFAIVIENEENPADEVE
MVDLERKFHALGMNVTIMHPVRRIDSFAQRYFSLVSVMYRARDEKTQWICCIDDDTFFPS
MYDLQAMLIKYDTSEPLYLGSLSEDWWAVQHYGLMGFGGAGIFLSLPMASIIYNNRNECS
ENLRTTAGDVTVMDCIYRFSTVKLTHIPGLHQIDMHGDLSGFYESGREMLSLHHWKEGSS
TEFKLEMEKMHLIADLCDSCFLQRWQFSNDVIVTNGFSISAFSKGHISQPKNLISDSAGM
EKINLDAVEYTWNDNINVLHSLAPTRDKLDESIKTSYRLLDSIHINENSSGIRQIYFREG
KQKSYYTGREMDTVIVLNWLQDNEKFSSDFRPG

Enzyme Prediction     

No EC number prediction in VDB92625.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	6.89e-12	227	354	212	341	hypothetical protein; Provisional
367085	Fringe	4.92e-09	218	332	79	203	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	2.44e-08	275	354	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDB92625.1|GT31	0.0	1	513	1	513
QSZ30396.1|GT31	1.44e-153	28	504	41	524
CCD56311.1|GT31	1.46e-147	39	508	60	523
ATZ54991.1|GT31	1.46e-147	39	508	60	523
APA14586.1|GT31	1.17e-134	135	507	1	371

PDB Hits     

VDB92625.1 has no PDB hit.

Swiss-Prot Hits     

VDB92625.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999812	0.000183

TMHMM  Annotations     

There is no transmembrane helices in VDB92625.1.