CAZyme Information: VDB90996.1

Basic Information

• Species: Blumeria graminis
• Lineage: Ascomycota; Leotiomycetes; ; Erysiphaceae; Blumeria; Blumeria graminis
• CAZyme ID: VDB90996.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		38774.22	4.4872

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgraminisTritici96224	8470	1268274	123	8347

• Gene Location: location=LR026991:7144699-7145805(+)

Full Sequence      

MFANYHRTLAYLLSFSSISVMAVPAPPAAAVAPMGAAVTIAVSDGGSAYPRANYLNNGKI
IGSYTAFPAGGQQVLTLVTSSDNGASWQFLGTAAQKPLSSGTLDNAFPIQLPSGRIILAY
RNHSQNAAGADTIYRITMSSSDDEGVSWQFLCDAVVVDSTPTNNGVWEPFLRNAGDGSLQ
LYFSHEQSAVDQDSVILSSRDGGITWGPEMAMSGAREHASRDGMIGVAEMGGNNLLGVFE
TNDNSGPFRLDTVSSADGGATWSDRKTLYAAPEGKNAGAPQIARVGQTLVVSFMTNEDDP
NAKLGTNWVDFADAKLLTSTDNGANWVKSTVFKAPAFWPGLTVLQDEKTFLYMAGSEGVV
KSQTIGLA

Enzyme Prediction     

No EC number prediction in VDB90996.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	46	304	1.8e-56	0.8827361563517915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	1.12e-13	66	304	104	333	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.36e-12	69	358	41	328	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	2.79e-11	74	274	81	263	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
271234	Sialidase_non-viral	5.82e-08	55	234	153	328	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	4.70e-05	169	339	17	199	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDB90996.1|GH93	4.77e-268	1	368	1	368
QGA18927.1|GH93	3.36e-85	45	367	46	355
QYS95310.1|GH93	2.65e-83	42	363	39	358
QKX54349.1|GH93	1.06e-82	41	368	39	363
UKZ88867.1|GH93	2.11e-82	42	351	39	344

PDB Hits     

VDB90996.1 has no PDB hit.

Swiss-Prot Hits     

VDB90996.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000400	0.999575	CS pos: 30-31. Pr: 0.9430

TMHMM  Annotations     

Start	End
9	31