CAZyme Information: VDB90415.1

Basic Information

• Species: Blumeria graminis
• Lineage: Ascomycota; Leotiomycetes; ; Erysiphaceae; Blumeria; Blumeria graminis
• CAZyme ID: VDB90415.1
• CAZy Family: GT15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
874	LR026991|CGC2	94729.07	5.4399

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgraminisTritici96224	8470	1268274	123	8347

• Gene Location: location=LR026991:1016343-1018967(+)

Full Sequence      

MDQLMLLVLVLAAIAGAKPVDQLKPGPITSSQLEAMPTPTSRSLERPSPIALVDDIFSTF
ILPSKNPQLIVTSTVTPIVAVRTTSTISGVMQILPSPGTLHPETLGTVLTTLDMLGHATN
PPVIETQIPSPTKLISPASVTLRTGSIESTPISHNIFQPIATDSPPGVFSTRPDHPVPRK
GIKSQTEPLSTNKFYSNFYLGSQTAQTWTHPYSLSWVKGGGSLKSWGMSITQLDASQKVY
GPDASANPVGYFTHPLGILSLVLSSSELKSSTCLTTDSLTSMSANVNLHPDDSAPAQIVF
PLVQGMGFVTAVFNSGTPTLESATLFRTFTKFSSAPKPCVSKFKMILEDDTTWLLYAYSP
SGADLDFTVVSNDLIQATSEFEGTIQIAKIPSTDTTAEHLYDAACGAFATSVDISGSADG
ESGSYTFSFAKGGLANTTLAMFALPHHISSLSPEMSASVSTLQLETTTKGKATAIIADSW
TMLEKLPTDMGFGPWNPQMQKKKYALSAATIKVIHTVACSEISQNMTKQTDLDSIYFSGK
ALAKFAGITYTLQELLGDPAMAQAGLENLKDSFALFSSNTNKFPLVYESAWKGIVSSATY
STGDPGVDFGNTYYNDHHFHYGYFILTAAIIGSMDPSWVSVNKAYVNTLVRDIANPSELD
PYFPVSRSFDWYHGHSWAHGLYESFDGKDQESSSEDSMSAYALKMWGHVSGDSNMEARGN
LQLAINARSIQNYYLYLRDNMVEPRKFTGNRVAGIMFENKIDYTTFFGSRPELIHGIHML
PLLPSSGLTRTQTFVQQEWDDFFSQGRVESAQGGWKSLLYANLAFIDAKSSWNYFSSSNF
NDATLDGGASRTWYMALAAGNVLLSLPPPALIDI

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	176	856	2.6e-214	0.9871382636655949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	109	860	11	754	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	505	855	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	9.23e-133	175	497	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDB90415.1|GH81	0.0	1	874	1	874
APA08036.1|GH81	0.0	70	860	93	885
QSZ30780.1|GH81	0.0	130	860	29	757
ATZ48291.1|GH81	0.0	72	860	71	861
CCD51604.1|GH81	0.0	72	860	71	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBZ_A	7.35e-97	134	859	6	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K3A_A	5.94e-96	149	859	1	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
4K35_A	6.00e-94	149	859	1	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	8.48e-28	536	833	340	635	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	2.81e-17	536	861	361	672	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	7.85e-252	125	860	162	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	7.14e-174	155	860	2	701	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.59e-160	155	860	46	736	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	1.25e-156	155	860	401	1111	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	4.64e-148	121	856	35	773	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999755	CS pos: 17-18. Pr: 0.9789

TMHMM  Annotations     

There is no transmembrane helices in VDB90415.1.