CAZyme Information: VDB89901.1

Basic Information

• Species: Blumeria graminis
• Lineage: Ascomycota; Leotiomycetes; ; Erysiphaceae; Blumeria; Blumeria graminis
• CAZyme ID: VDB89901.1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293	LR026990|CGC1	31889.56	4.5945

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgraminisTritici96224	8470	1268274	123	8347

• Gene Location: location=LR026990:15631179-15632060(+)

Full Sequence      

MRLSAYLVIAISTGSTNAYWKGFNAQANKVDGSCKTQADWTSDFNILKSFPGNFNSIRLY
ASSDCNTLANAVPAALATGIKLLAGVWTQNENHFEAEKQELLAAVQKYGFDWIAAVSVGS
EDLYRAETTPNRLAEQIYDVRGMLSTVAGYSSNIQVGHVDTWTAWVNNANIPVIKACDFI
GTDGYPYFQSNDTNSVQNGNKLFQESLDAVRNSVAAVGSGAWVWVTESGWPITGNTLNQA
VPSIENAQLYWKTVACPLFTSAHTFWYSLQDVGVSPSFGVLDANGKPLYDLSC

Enzyme Prediction     

No EC number prediction in VDB89901.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	44	293	5.4e-22	0.9389067524115756

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.00e-52	10	284	39	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	3.44e-23	22	293	2	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDB89901.1|GH17	2.39e-221	1	293	1	293
CCD34315.1|GH17	7.40e-138	4	293	5	294
ATZ46547.1|GH17	7.40e-138	4	293	5	294
APA06410.1|GH17	6.90e-134	4	293	5	295
QSZ35382.1|GH17	9.79e-134	3	293	4	295

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.74e-23	14	287	33	290	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.23e-22	14	287	33	290	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UUZ1|EGLC_ASPOR	1.18e-71	1	293	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	3.02e-71	1	293	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	3.34e-71	1	293	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	6.64e-71	1	293	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	5.47e-68	1	293	1	311	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.436893	0.563112	CS pos: 18-19. Pr: 0.5390

TMHMM  Annotations     

There is no transmembrane helices in VDB89901.1.