CAZyme Information: VDB88801.1

Basic Information

• Species: Blumeria graminis
• Lineage: Ascomycota; Leotiomycetes; ; Erysiphaceae; Blumeria; Blumeria graminis
• CAZyme ID: VDB88801.1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1457	LR026990|CGC2	165710.57	5.3990

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgraminisTritici96224	8470	1268274	123	8347

• Gene Location: location=LR026990:1322775-1327455(-)

Full Sequence      

MIGLNLQCVWTGILLVTTCILQNRQLGFVQAGPSINLELKTAFSSAPYLLELLETAAEEN
STSYFPLLNRVADGYFADASSDQKVYERFLKILQDDGHITEPADLSAYQLALSMRVSAPR
IESHYQYYRTAFCANIDERNIHELEFDRILGNVSAQTAILYADITSPTFGEFHHMLMNQA
LDGNLSYRIRHKNREFTSVSKPISTSGWGVELALKSTDYIVIDDRGEEKDEGKIENENSE
NTDTEFKSKVKLNEDEVEDLRPLSASELSPLGVKAGSYVMQSKSPLDTLLSVTRDFPKYS
SQLVSHKVAPQFLDEHRYNRNQLVPEGHGIIWMNGIQLIDRQIEAFNLLDVLRKERHLIS
GIRALGLTAADAIRLVSHPLVSTAQSTNEDQRYDWRDEKEGGNAIIWMNNLEEDPRYAEW
PRALSAMLQRVHPGQLPTIRRDSFNLVVPIDFSEPEDIALVVNTLLSFVTRRLCVRIGIV
PITLTPSAVNQAKIIYHLTNTYGLQSAVTYLVRSSEAKLEEGFSSLTFDHATRVGKPINE
KPQLSLKEVLESDEIRKQIEASKKWLHRLSAEDSIPPVFMDGVVIPRLDSWLQTAIFHGV
FEEEEDQVWLPSIFLDEALSNRNPLIIPENPRSLKVFDLHVLLSKYQDLVNELPRLEADP
SSIHSDSAYIILIADLNSIAGQKLAITTADFGEKTLSIDLRIAHNPLSCTSSGLSDNIYA
HLRDRGFSGWERNGSLKNVLTSESVSRDEALQTESAKFWKSLSPFIETLGLLPGQNAILI
NGRLVGPIPDSSASGWSLEDLITLLSYERRKRITPTHAAMIDLGLGHKIQSVVEAAKFSS
KVALSTLPDPTEEFFEQPSISRMNKFDMWKSNHTAIEIGNPETSDIQLTVILDPASHQGQ
RWVAILKVLSELQGVYMKLFLNPKERLTELPVKRFYRFVLESKPSFDSNGDVKAPRAIFK
DMPQSALMTIGMDLPPTWLVAPKVSVHDLDNIKLSSVKIDVEAIYELEHILIEGHCHEAI
GGRSPRGVQLVLGTERDAHVGDTIIMANLGYFQFKANPGYYRIRLQEGRSSEIFHIDSVG
AHNWKEFIEENSDVIMMSFKGTTLFLRLSRRIGMGTEDVLEPSTDSNRGLVSQGLKLAQD
LFNWKGQQPTNTQADINIFSVASGHLYERMLNIMMVSVMKNTNHTVKFWFVEQFLSPSFK
DFIPYLANQYEFQYEMVTYKWPHWLRAQTEKQREIWGYKILFLDVLFPLSLDKVIFVDAD
QIVRTDMIELVQHDLNGAPYGFTPMCDSRTEMEGFRFWKKGYWEKFLRGLPYHISALYVV
DLRRFRRIAAGDRLRQQYHALSADPGSLANLDQDLPNHMQNVLPIHSLPQEWLWCETWCS
DDALVNAKTIDLCNNPLTKEPKLDRARRQVPEWTIYDDEIALVAKQRQQVPREEDRSMEK
IDLEVEVQKAQQQRDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1156	1403	4.6e-132	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1156	1421	1	266	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	2.19e-175	1156	1403	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	8.19e-79	393	626	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	5.17e-56	1013	1121	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.
132996	Glyco_transf_8	6.32e-56	1156	1403	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDB88801.1|GT24	0.0	1	1457	1	1457
QSZ31337.1|GT24	0.0	29	1430	26	1459
APA14047.1|GT24	0.0	29	1427	25	1457
ATZ47226.1|GT24	0.0	31	1439	27	1469
CCD34486.1|GT24	0.0	31	1439	27	1469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	27	1432	3	1457	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	27	1432	3	1457	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	0.0	27	1432	3	1457	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	27	1432	3	1223	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	0.0	33	1365	2	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.51e-257	31	1423	18	1424	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	7.61e-229	34	1420	46	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	2.33e-224	34	1420	46	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	8.95e-224	34	1420	46	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	5.67e-218	39	1420	34	1504	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000830	0.999139	CS pos: 31-32. Pr: 0.8123

TMHMM  Annotations     

There is no transmembrane helices in VDB88801.1.