CAZyme Information: VDB86350.1

Basic Information

• Species: Blumeria graminis
• Lineage: Ascomycota; Leotiomycetes; ; Erysiphaceae; Blumeria; Blumeria graminis
• CAZyme ID: VDB86350.1
• CAZy Family: GH63
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	LR026988|CGC9	40119.15	4.8614

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgraminisTritici96224	8470	1268274	123	8347

• Gene Location: location=LR026988:18802342-18803491(+)

Full Sequence      

MVTWTQLYVAATWLFIACRAVKVFPTPKSSGWIPSLTNLVVFGDSYTDESRLPYFINHNG
TAPPTGFLPPASNATAGGGMTWARHVAKSTGAKLYNYAVSGAVCDNNLVNRYISVLYGPF
PDVVYEVNAFVSDSTFINETTNTPFFADRDESNTIYSIWIGTNDLGVNGFLTDSNLHESS
LPSFTDCIMDKFDQIYANGGRYMVLMNLAPLQLTPLYGMPQVGGLSKSSYWGEKPTNTSE
ISGKMKEYTKTVNSLLSYRIPYEKLIAERYPDASFAIFDTNSLITDIYNSPNDYLVAPAN
STHQYFKCDPVPWGKCVRQPEGLDHYLWFDELHPGEKTNEVIAGEFVKLVQGTSSYATYW

Enzyme Prediction     

No EC number prediction in VDB86350.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	39	346	5.7e-65	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	5.63e-47	38	347	1	268	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	1.97e-15	41	346	5	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	6.44e-08	37	165	2	115	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	1.42e-07	39	343	1	221	GDSL-like Lipase/Acylhydrolase.
225780	COG3240	9.53e-06	34	343	27	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDB86350.1|CE16	1.28e-277	1	360	1	360
CCD46398.1|CE16	8.45e-148	28	360	55	387
ATZ51743.1|CE16	1.41e-147	28	360	70	402
APA05712.1|CE16	4.56e-147	14	360	10	365
QSZ33601.1|CE16	8.80e-141	25	360	30	359

PDB Hits     

VDB86350.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	9.86e-89	19	360	15	345	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.985855	0.014172

TMHMM  Annotations     

There is no transmembrane helices in VDB86350.1.