CAZyme Information: VDB86338.1

Basic Information

• Species: Blumeria graminis
• Lineage: Ascomycota; Leotiomycetes; ; Erysiphaceae; Blumeria; Blumeria graminis
• CAZyme ID: VDB86338.1
• CAZy Family: GT76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314	LR026988|CGC10	36353.90	9.2914

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgraminisTritici96224	8470	1268274	123	8347

• Gene Location: location=LR026988:18721878-18722911(-)

Full Sequence      

MRRATAIFIVINATIILYLLHACSTLIGLLFEDGAADIISSEEIPALETKWSKNSTQLIP
KIIHQTYINESIPSQWILSQKSCLNLHQDYEYKVESRNFIASQFPWFLKNFDDYPYAIQR
ADAIRYFVLAHFGGIYIDLDDGCNRRLDPLLAFPAWLRRTVPTGISNDAMGSVPQHPFFL
KAINSLQTYQRNWGAPYLSVMYSTGPLFLSVLWKEYMHGYRPAEEHVRILTLNNYKGFPE
SFFNVTKGNSWHREDAKAVLWMGKHWMLLTVSGFAAAIVIGSFLWMLWNRIFSRPTKSRR
WKSGAHYELVDRQA

Enzyme Prediction     

EC	2.4.1.-:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.24e-65	55	303	78	330	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	9.47e-21	73	152	1	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDB86338.1|GT32	2.08e-237	1	314	1	314
QSZ30681.1|GT32	1.04e-143	1	314	1	326
CCD51739.1|GT32	4.23e-143	1	312	1	324
ATZ48182.1|GT32	4.23e-143	1	312	1	324
APA07946.1|GT32	1.99e-141	1	314	1	326

PDB Hits     

VDB86338.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	1.49e-90	1	301	1	309	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.79e-90	1	305	1	307	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	5.80e-77	54	302	52	319	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	4.72e-76	58	300	81	332	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	1.22e-46	59	297	64	304	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.102476	0.897522	CS pos: 22-23. Pr: 0.7996

TMHMM  Annotations     

Start	End
7	29
266	288