CAZyme Information: VDB84387.1

Basic Information

• Species: Blumeria graminis
• Lineage: Ascomycota; Leotiomycetes; ; Erysiphaceae; Blumeria; Blumeria graminis
• CAZyme ID: VDB84387.1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600	LR026988|CGC4	69851.91	7.2898

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgraminisTritici96224	8470	1268274	123	8347

• Gene Location: location=LR026988:9771520-9773376(-)

Full Sequence      

MRSRQSYMLICALLFIFLLFTYNRPRLNLQSLQPDLQQSINKPIAPVKTLPATATNTEPT
PVKNSSHPIWQLILDNEKDWKKKLARQSQSLSEAVTEYRRRYGIHPPPNFDKWYEFAKAR
NVRFIDEYDNIQQNLAPFWGLKPATIRARAREAIGFDANNLIGALIRNGELQKIAGGSEW
QMEATEGMMDGFIKYLPDMDLAFNIHDEPRVLVPYEDLTRLIFIADNQTKPVANATLEPI
NSWSTRPVDMNDGSRFEDVRRTRFNVFAHQPTWAHSRISCSPDSPARILEDNQMADNLKN
YAMGELGFIYNQTAHSDICQSPSFSNKHGFFDRPNAFNVAQDLIPVFSQSKISSFNDILY
PSPWYWSGKVPYDSSIDPTWAEKKDQVYWRGSTTGGFSRDGSWRRQHRQQMVQKINSNDR
AKILVNKSEDSSEDWQTKEVPRSDFKELFDVHFTHVDQCDPADCDAQKEFFSIKGWAKQN
TAWKYKYLIDVDGNAFSGRFYAFLKSRSLIYKLAIFREWHDEWLKPWFHYIPMSLKGDEW
VEAVRWFAGEAPGKKNAEKIALQGKEWADKILRNEDLEAWFFRLLLELVDDNREVIGYKP

Enzyme Prediction     

No EC number prediction in VDB84387.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	325	588	9.9e-80	0.952

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	5.97e-20	345	589	32	250	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.70e-10	344	587	107	318	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDB84387.1|GT90	0.0	1	600	1	600
APA08219.1|GT90	6.22e-296	1	598	48	652
CCD51306.1|GT90	5.55e-292	1	598	48	652
ATZ48502.1|GT90	5.55e-292	1	598	48	652
QSZ35850.1|GT90	7.42e-291	1	598	52	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	5.31e-08	332	587	105	337	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	2.39e-06	345	589	154	376	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.67e-53	66	587	151	651	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	1.82e-07	337	585	156	382	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	3.10e-07	332	587	133	365	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	3.10e-07	332	587	133	365	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	9.83e-07	341	585	159	381	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999866	0.000154

TMHMM  Annotations     

Start	End
7	24