CAZyme Information: VDB84331.1

Basic Information

• Species: Blumeria graminis
• Lineage: Ascomycota; Leotiomycetes; ; Erysiphaceae; Blumeria; Blumeria graminis
• CAZyme ID: VDB84331.1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516	LR026988|CGC9	59530.84	10.0715

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgraminisTritici96224	8470	1268274	123	8347

• Gene Location: location=LR026988:9174597-9176346(+)

Full Sequence      

MWRRTYILLVLIRLYFALSPSYLHPDENFQGPEVIAVFSYPIRLTWEFTSTNPVRSVFPL
WPVYGLPMLLLRWLWMGNKNNNHVPPIAAFWTLRVLMFVLSFVLEDWALHELIQIPKHRK
VAVMLVASSYVTWTYQTHTFSNSIETLAVAWSLVLIQRIVENKKRSSCFASAILAFVAVF
GIFNRITFPAFLLIPSLRLVPHFINKPSAFLATLLSTITFTFIAITIDTNFYSEKNITWS
HLLSHPFVTPINNLKYNLSPKNLAQHGLHPWYQHGAFNLPQLVGPIIFLLLRPKFNMRLY
SAMSGIFVLSLFQHQEARFLLPAVPLILSSVKLPKNQIILKLWASAWIIFNVLFGVLMGV
YHQGGVVPTQVFLSKQPDATHAVWWKTYNPPIWLLDGKNEVLTTHEKMGMDGDLMLRDLR
ALATCRNNSNSTNPTPKKEGVYLVAPLSAIFLENYIDNQESEHLYFQEVWHYKRHLNLDD
LDFVSDGLWPTIKRVVGRRGIGAWKITKDCNESIKR

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	5	394	1.6e-73	0.9897172236503856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	1.45e-45	5	393	2	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDB84331.1|GT22	0.0	1	516	1	516
UNI14407.1|GT22	5.62e-263	1	510	1	515
QLI65346.1|GT22	1.03e-262	1	512	1	517
QPH02021.1|GT22	2.70e-259	1	510	1	515
APA07854.1|GT22	9.75e-259	3	515	5	513

PDB Hits     

VDB84331.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	6.37e-251	1	510	1	515	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	5.27e-173	1	511	1	543	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q4WTT7|SMP3_ASPFU	6.89e-172	1	504	1	539	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q5BAX7|SMP3_EMENI	2.68e-171	1	504	1	534	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	1.46e-91	10	482	13	495	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.163444	0.836539	CS pos: 23-24. Pr: 0.2822

TMHMM  Annotations     

Start	End
57	76
91	113
172	194
209	231
342	364